KEGG   Prochlorococcus marinus MIT 9313: PMT2174Help
Entry
PMT2174           CDS       T00143                                 

Gene name
desC
Definition
Fatty acid desaturase, type 1 (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pmt01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pmt01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2300938..2301717
Genome map
AA seq 259 aa AA seqDB search
MIAIHALSILALLPRFWSWQAITTLLVLYWVTACLGVTIGYHRLLSHRSFRVPHWLERFF
ATCGTLSCQHGPIDWVGLHRHHHKFSDTDPDHHNSHKGFWWSHMGWMFEPIPAMRVVPRL
TVDLAADPYYRWLNKYFLLLQLPLAGLLFWIGSVSGAGGLALVLWGIPLRLTIVYHITWL
VNSASHCWGTVAFDSGDNSRNNPWVAALTFGEGWHNNHHAFPHSAIHGLQRGQIDLTWQH
IRLMRALGLARKIRLPITS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccattcatgccctatccatcctggccctgttgccccgtttctggagctggcaa
gcgatcacaacccttctcgtcctctactgggtcacggcctgcctcggcgtgacgatcggc
taccaccgtctgctctcacaccggtctttccgagtaccccactggctggagcgcttcttt
gccacctgcggaaccttgagctgccaacacggtccaatcgactgggtaggactccatcgc
caccatcacaagttttccgatactgaccccgaccaccacaacagtcataagggcttctgg
tggagccacatgggctggatgtttgaacccattccagccatgcgggtcgtgccacgcctc
actgttgacctggcagcggatccctattaccgctggcttaacaagtactttctactgttg
cagctcccgctagccggtttgctcttctggatcggcagcgtcagtggagccggtggtttg
gccctcgtgctgtggggtatccccttgcgcctaacgatcgtgtatcacatcacctggctg
gtcaattccgccagtcactgctgggggactgtggccttcgacagcggtgacaactcccgc
aacaacccttgggtagcagctcttacttttggcgaaggttggcacaacaaccaccacgcc
ttcccgcactccgccattcatggactccagcgcggtcagatcgacctcacctggcagcac
atccgcctcatgcgagccctaggcttggctcgcaagatccggctaccgatcacatcgtaa

DBGET integrated database retrieval system