KEGG   Prochlorococcus marinus MIT 9313: PMT2174Help
Entry
PMT2174           CDS       T00143                                 

Gene name
desC
Definition
Fatty acid desaturase, type 1 (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PMT2174 (desC)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PMT2174 (desC)
Enzymes [BR:pmt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PMT2174 (desC)
Lipid biosynthesis proteins [BR:pmt01004]
 Desaturase
  First
   PMT2174 (desC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2300938..2301717
Genome map
AA seq 259 aa AA seqDB search
MIAIHALSILALLPRFWSWQAITTLLVLYWVTACLGVTIGYHRLLSHRSFRVPHWLERFF
ATCGTLSCQHGPIDWVGLHRHHHKFSDTDPDHHNSHKGFWWSHMGWMFEPIPAMRVVPRL
TVDLAADPYYRWLNKYFLLLQLPLAGLLFWIGSVSGAGGLALVLWGIPLRLTIVYHITWL
VNSASHCWGTVAFDSGDNSRNNPWVAALTFGEGWHNNHHAFPHSAIHGLQRGQIDLTWQH
IRLMRALGLARKIRLPITS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccattcatgccctatccatcctggccctgttgccccgtttctggagctggcaa
gcgatcacaacccttctcgtcctctactgggtcacggcctgcctcggcgtgacgatcggc
taccaccgtctgctctcacaccggtctttccgagtaccccactggctggagcgcttcttt
gccacctgcggaaccttgagctgccaacacggtccaatcgactgggtaggactccatcgc
caccatcacaagttttccgatactgaccccgaccaccacaacagtcataagggcttctgg
tggagccacatgggctggatgtttgaacccattccagccatgcgggtcgtgccacgcctc
actgttgacctggcagcggatccctattaccgctggcttaacaagtactttctactgttg
cagctcccgctagccggtttgctcttctggatcggcagcgtcagtggagccggtggtttg
gccctcgtgctgtggggtatccccttgcgcctaacgatcgtgtatcacatcacctggctg
gtcaattccgccagtcactgctgggggactgtggccttcgacagcggtgacaactcccgc
aacaacccttgggtagcagctcttacttttggcgaaggttggcacaacaaccaccacgcc
ttcccgcactccgccattcatggactccagcgcggtcagatcgacctcacctggcagcac
atccgcctcatgcgagccctaggcttggctcgcaagatccggctaccgatcacatcgtaa

DBGET integrated database retrieval system