KEGG   Prochlorococcus marinus MIT 9313: PMT2274Help
Entry
PMT2274           CDS       T00143                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMT2274 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMT2274 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PMT2274 (thrC)
Enzymes [BR:pmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PMT2274 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2409528..2410637
Genome map
AA seq 369 aa AA seqDB search
MVSLSQNLPQAISTTPVMQDWPGLIEAYRSWLPVSETTPVVTLKEGATPLIPVSSIAEQI
GRGVKVYVKYDGLNPTGSFKDRGMTMAISKAKEANCEGVICASTGNTSAAAAAYAKRAGM
RAFVLIPDGYVAQGKLAQALVYGAEVLAIRGNFDRALDIVQEMALKYPVTLVNSVNPYRL
QGQKTAAFEIVDALGEAPEWLCIPMGNAGNITAYWMGFQEYKQAGKCQLLPQMMGFQASG
SAPLVFNKTVNNPNTIATAIRIGNPVNKEKAIAAKSSSNGAFLDVSDEKILEAYKLLGRE
EGIFCEPASAASVAGLLKRASEVPSGATVVCVLTGNGLKDPDCAINNNDAIFHADLNPDL
TTVAHVMGF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
ttggtgtccctcagccaaaacctccctcaagctatctccacaacgcctgtgatgcaggat
tggcctggcctaatagaagcgtatagatcctggttaccggtaagcgaaaccacacctgta
gtgaccctcaaagaaggagcgacgccattgatccctgtcagctccatagctgaacagatt
ggcaggggagtcaaggtctacgtgaaatacgacggcctcaaccccacagggtcctttaag
gacagaggcatgactatggcgatcagcaaggccaaagaagctaattgtgaaggagtcata
tgtgccagtacaggcaacacatctgctgctgctgctgcatatgcaaaacgcgctggtatg
cgtgcttttgtattaattccagacggttatgtagcgcaaggaaaattagctcaagcttta
gtttatggcgctgaagtgctagcaattcgaggcaattttgatcgtgctctcgacattgtt
caagaaatggccttgaaatacccagtaactctggtgaattccgttaacccctaccggctt
caaggtcaaaaaactgcagcctttgaaattgttgatgctctcggagaagcgccagaatgg
ctgtgcatcccaatgggtaatgcaggtaacatcactgcttattggatgggttttcaagaa
tacaaacaagccggaaaatgtcaacttctaccacaaatgatgggattccaagcaagtggg
tctgctccattagttttcaacaagaccgtaaacaatccaaatacaattgcaacagcaatt
agaataggcaacccagtcaacaaagaaaaggccattgccgcaaagtcaagcagtaatgga
gcctttcttgatgtttcagatgaaaaaattctagaagcttacaaattgcttggtcgcgag
gaaggcattttctgtgaacctgcaagtgctgcttctgtagcaggattattaaaacgtgcg
tctgaagtcccttcaggggcaacagttgtatgtgtccttactggcaacggtttaaaagat
ccagattgtgccatcaataacaacgatgcaatatttcatgcagatctaaatccagatcta
accactgtggctcatgtcatgggtttttaa

DBGET integrated database retrieval system