KEGG   Pasteurella multocida subsp. multocida Pm70: PM0071Help
Entry
PM0071            CDS       T00046                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PM0071
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    PM0071
Enzymes [BR:pmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PM0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(97334..98389)
Genome map
AA seq 351 aa AA seqDB search
MSTLLIDLQGQELSQEEVELLSHPLVAGLILFTRNFHDRAQMQALIQSIRQRVKKPLLIT
VDQEGGRVQRFREGFTQLPAMQAFACLIDDPVQQTNMAQQAGWQMAAEMTALGIDLSFAP
VLDLGHQCQAIGDRSFHSQAEMTLNLASAFIDGMHQVGMAATGKHFPGHGHVIADSHLET
PYDERPKQQIFAQDIQPFQQLIQQNMLNAIMPAHVIYSQCDPQPASGSAYWLKQVLRQQL
GFNGAIFSDDLGMKGAGFMGNFVQRCEQSLQAGCDLLLLCNEREGVIQVLDNLKLSETEP
HFALRQQRLQQLFKRKTIRWSELEATSRWLENRKILTALQQRWLDNKANKH
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacactattgatcgatttacaaggtcaagaacttagccaagaagaagtcgagctg
ttatcacatcctttagtagcagggctcattttatttacacggaatttccatgatcgcgcc
caaatgcaagcgctgatccaatcgattcgtcaacgcgtcaagaagccgttgttgattacg
gtggatcaagaaggtgggcgagttcagcgttttcgtgaaggtttcacccaacttcctgct
atgcaagcctttgcctgtttaattgatgatcctgtacaacaaacaaacatggcacagcaa
gctgggtggcaaatggcagcagaaatgaccgcacttggtattgatctcagctttgcgcct
gttttagatttaggacatcaatgtcaagccattggcgaccgcagttttcattcacaagca
gaaatgacactcaaccttgccagcgcctttattgacggtatgcatcaagtgggaatggcc
gccacgggtaagcattttccgggtcatggtcatgtgattgcagattcacatttagaaacg
ccttatgatgaacgtccaaaacaacagatctttgcgcaagatattcagccattccagcag
ttgattcaacaaaatatgctcaatgccatcatgcctgcacatgtgatttatagccaatgc
gatcctcaacctgcgagtggttctgcatattggttaaaacaggtactacgccaacaactt
ggctttaacggtgctattttctctgatgatctcggtatgaaaggcgcgggctttatgggg
aattttgtgcaacgttgtgagcaatctttgcaggcgggttgtgatttactgttactgtgt
aatgaaagagaaggcgttatccaagtgttagataatttaaaactttctgaaacagagccg
cactttgccctacgtcaacagcgtttacagcagcttttcaaacgtaaaactattcgttgg
tctgaattggaagccacttcacgttggttggaaaatcgcaaaatattgaccgcacttcaa
caacgctggcttgataacaaagccaacaaacattaa

DBGET integrated database retrieval system