KEGG   Pasteurella multocida subsp. multocida Pm70: PM0115Help
Entry
PM0115            CDS       T00046                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PM0115 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PM0115 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PM0115 (thrC)
Enzymes [BR:pmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PM0115 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
140879..142153
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKHPEEQVNFAQAVRQGLGKNQGLFFPETLPHFEDMDALLALPLVERSQKILSAL
IGEEISPTQLAKMVENAFTFPAPVAKVEEGVYALELFHGPTLAFKDFGGRFMAQALATVR
GEGKITILTATSGDTGAAVAHAFYGLENIDVVILYPQGKISPLQEKLFCTLGGNIRTIAI
NGDFDDCQALVKQAFDDAELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKAARDNLV
VSVPSGNFGNLTAGLIAKSLGLPIKRFVASTNVNDTVPRYLRSGNWQPHDTVATLSNAMD
VSRPNNWPRVEELFKRNGWALSDLHSDAVNDNETEQTLKDMYAKGYLCEPHGAVAYRVLK
QDLQPGETGLFLCTAHPAKFKESVERILALELPLPDALAKHAALPLLSDIMENDFAKLRA
YLLA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaacattaaacatccagaagaacaagtcaattttgcgcaagcggtacgt
caaggattaggcaaaaaccaagggttattttttccagaaaccctaccgcactttgaggat
atggatgcgctgttagcgttaccattggtggagcgtagccagaagattttatctgcgtta
attggtgaggaaatttcgccaacccagttagcaaaaatggtagaaaatgcctttactttc
ccagcacctgtagcaaaagtggaagagggggtttatgcattggagttatttcatggtcca
accttagccttcaaagactttggtggtcgttttatggcgcaagccttagctacagtacgt
ggtgagggcaaaattacgattttaacggcaacgtcaggggatactggagcggcggttgcc
cacgctttttatggtttagaaaacattgatgtggtgattttatatccacaaggcaaaatc
agcccgctacaagaaaagttattctgtacgcttggtggcaatattcgtacgattgcaatc
aacggggattttgatgattgtcaggcattagtgaaacaagcgtttgatgatgcagagttg
cgtcaagcgattggcttaaactcagcaaattcgatcaatatcagccgtttattagcgcag
gtttgttattactttgaggcggttgcgcaattaccaaaagcggcacgcgataatcttgtg
gtatcggtaccaagtggtaactttggtaacctgaccgcaggcttaattgccaagtcttta
ggcttgccaattaaacgttttgtagcgtcaaccaatgtgaatgataccgtaccgcgttat
ttacgcagtggcaattggcaaccgcatgacacggtggcgacgttatccaatgcaatggat
gtgagtcgtccaaataactggccacgggttgaagagttatttaaacgcaatggttgggcg
ctatcagatttgcattctgatgccgtaaatgacaatgaaacggaacaaactttaaaagat
atgtatgccaaagggtacttgtgtgaaccacatggtgcggtggcttatcgtgtgttaaaa
caagatttacagccaggtgaaaccggcttattcctctgtacggctcatcctgcgaaattt
aaagaaagtgttgaacgtattttagcgcttgaattacctttacccgatgcattagcaaaa
cacgcggctttaccgttgctttcggatatcatggaaaatgattttgctaaattacgtgcg
tatttgttagcttaa

DBGET integrated database retrieval system