KEGG   Pasteurella multocida subsp. multocida Pm70: PM0137Help
Entry
PM0137            CDS       T00046                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pmu00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pmu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
161615..163099
Genome map
AA seq 494 aa AA seqDB search
MRRLTALLGQVELAPNIELTEMILDSRAVKQGCLFVALQGHQVDGRQYIPQAIAKGASAV
LAETEDAQQHLSTKIEQGVPIISFYQLGSHLSALAGLFYDNPSHKLTLVGVTGTNGKTTI
SQLLAQWTTLLGHRSAVMGTIGNGLLGQVKEATNTTGSAVEVQASLADFVKRGADFAAIE
VSSHGLVQHRVEALAFDVAIFTNLSRDHLDYHQSMENYALAKKRLFTELNSRHQIINADD
SVGQTWLQEQPNAVAVSCQTDFKPHQARWLKATAIQFSQKGARIQFESSWGKGELHSALI
GQFNVSNLLLVFATLLSLGYDIEKLMKTVPQLTGVCGRMERLSASNQPTAIVDYAHTPDA
LEKALQAARLHCQGKLWCVFGCGGDRDRGKRPIMAKIAEQFADHVIVTDDNPRTESAAQI
VQDILAGFEHPQHVEVCHARDQAIIQALQKADSDDVVLIAGKGHEDYQIIGTQKQHFSDQ
ETVQQYFKVNHHHA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagattaaccgcacttttggggcaagttgaacttgccccaaatattgaattgacg
gaaatgattctagacagtcgggctgtaaagcaaggctgtctttttgttgcattacagggg
caccaagttgatggacgtcagtatattccgcaagccatcgccaagggggcaagtgcggtg
ttagctgaaacagaggatgcacagcagcatttgagcacgaaaatagaacaaggggtgccg
atcatttcgttttatcaattaggctctcacctttctgcgttagcggggcttttttatgat
aatccgtcgcacaaattgaccttggttggggtgacgggcacgaatggcaaaactactatt
tcgcaattattagcgcaatggacaacattactggggcatcgcagtgctgtgatgggaacg
attggcaatgggttgttggggcaagtgaaagaagcaaccaataccactggatctgcggtg
gaagttcaagcttctttagcggattttgttaagcgaggtgcagatttcgccgcgattgag
gtttcatcacatggactagtgcagcaccgcgttgaagcgttagcctttgatgttgctatt
tttactaatctcagccgtgatcatttggattatcatcaaagtatggaaaattatgcgttg
gccaaaaaacgcttatttaccgaattgaattcccgacaccaaattattaatgcagacgat
agcgtcggacaaacttggttacaggaacaacccaatgcagtagccgtcagctgtcagaca
gattttaaacctcatcaagctcgttggttgaaagcaactgcgattcagtttagtcagaaa
ggtgcacgaattcaatttgaatcaagttggggaaaaggcgaattacatagtgcgttgata
gggcagtttaatgttagtaatttgctgttggtgtttgctaccttactttcattgggctat
gacattgaaaaactcatgaagacggtgcctcaattaacgggggtatgtggtcggatggaa
agattaagtgcatcaaaccaacctaccgcgattgtggattatgcccatacgccagatgcg
ttagagaaagctttgcaagcagcgcgattacattgtcaggggaaattgtggtgtgtgttt
ggttgtggtggtgatcgtgatcgtggtaaacgtcctattatggcgaaaattgcggagcaa
tttgctgatcacgtgattgtgacagatgataatccgcgtactgaatccgcggcgcaaatt
gtgcaagatattctggctggatttgaacatccgcaacacgttgaggtctgccacgctcga
gatcaagcgattattcaggcattacaaaaagcagatagcgatgatgtcgtgctgattgcg
ggaaaagggcatgaagactatcaaattatcggcacacagaaacagcatttctctgatcaa
gaaaccgtacaacagtattttaaggtaaatcatcaccatgcttaa

DBGET integrated database retrieval system