KEGG   Pasteurella multocida subsp. multocida Pm70: PM0188Help
Entry
PM0188            CDS       T00046                                 

Definition
hypothetical protein
Orthology
K12248  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 0160) [EC:2.4.99.1]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Brite
Enzymes [BR:pmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     PM0188
Glycosyltransferases [BR:pmu01003]
 Terminal extension
  Bacterial sialyltransferase
   PM0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(209934..211172)
Genome map
AA seq 412 aa AA seqDB search
MKNRRLNFKLFFLIIFSLFSTLSWSKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFG
LSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELDIHLNIAHSVQLIRPI
LAYRFKHLDRVSIQRLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFD
NPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAF
YLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTDVREYYAQQQLNLLNHFTQAGGDLFI
GDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFS
LPKEKISHIIFTSNKQVKSKEDALNNPYVKVMRRLGIIDESQVIFWDSLKQL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcgtcgactcaatttcaaactgtttttcctcatcattttttcattattcagc
acactgagttggtcaaaaacaatcacgctgtatttagatcctgcctccttaccggcatta
aatcagctgatggactttacgcaaaataatgaagataaaacacatccacgtatttttggt
ctttctcgctttaaaatccctgacaacattattacacagtatcaaaatatccatttcgtc
gaactcaaagataatcgtcccactgaagcactttttacgattttggatcaataccctggt
aacattgagttagatatacacttaaatattgctcattccgttcaattaattcgtccgatt
ttggcatatcgttttaaacatttagatcgtgtatcaattcagcgattaaatctttatgac
gatggctcaatggaatatgttgatttagaaaaagaagaaaataaagatatttccgcagaa
attaagcaagcagaaaaacaactttctcactatttgcttaccggtaaaataaaatttgat
aacccaactattgctcgttatgtctggcaatccgcgttcccagtaaaatatcatttttta
agtacagactattttgaaaaagccgaatttttacaaccactaaaagaatatttagcggaa
aattatcaaaaaatggactggaccgcttaccaacagctgactccagaacagcaagcattc
tacttaacattggtaggcttcaatgacgaagtcaagcagtcgctagaagtgcaacaagcc
aaatttatctttaccggcacgacaacttgggaaggaaataccgatgtgcgagaatactac
gcacagcaacaacttaatttacttaatcactttacccaagctgggggcgatttatttatt
ggtgatcattataaaatctactttaaagggcatcctagaggtggtgaaattaatgactac
attctgaacaatgctaaaaatatcaccaatatccctgccaatatttcctttgaagtattg
atgatgacaggcttattacctgataaagtgggtggtgttgcaagttcactgtatttctcc
ttaccaaaagaaaaaattagccatattattttcacatcgaataaacaagtgaaaagcaaa
gaagatgcgctaaataatccgtatgttaaggtcatgcgtcgtttaggtataattgacgaa
tcacaagtcatcttttgggacagtttaaaacagttgtaa

DBGET integrated database retrieval system