KEGG   Pasteurella multocida subsp. multocida Pm70: PM0191Help
Entry
PM0191            CDS       T00046                                 

Gene name
dsbC
Definition
protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Brite
Enzymes [BR:pmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PM0191 (dsbC)
Secretion system [BR:pmu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PM0191 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
214049..214732
Genome map
AA seq 227 aa AA seqDB search
MKKILSTLLMLGMSSLTFANSQQVVEQLQKMGLSGVEVSDSPVKGIKTAVTDNGIFYITE
DAKYILDGKLYALSEKGLRDVSSSLLLDKLTAYKNEMVVYPAKDEKHVITVFMDTSCHYC
KVLHKQIKEYNDLGITVRYLAFPRGGVQSKTAREMEAIFTAQDPQFALTEAINGNPPKTL
KDANITKKHYQLGLQFGVNGTPSIVTEKGELIGGYLKPADLLSELAQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcttgagcacacttttgatgttggggatgtcgagtttgacgtttgccaat
tcacagcaagtggtagaacagttgcaaaaaatgggcttatctggtgtagaagtgagcgat
tcgcctgtgaaaggcatcaaaaccgcagtgacggacaatggtattttttacatcacagag
gacgcgaaatatattcttgatggtaagttatatgcactgtcagaaaaaggattacgcgat
gtgtcatcaagcttattactagataaattaacagcttataaaaatgaaatggtcgtttat
cccgcaaaagacgaaaaacatgtgattaccgtgttcatggatacttcgtgccattactgc
aaagtgttacataaacaaattaaagaatataatgatctcggtattacagtacgttacctt
gctttcccgcgtggtggcgtgcaatcgaaaacagcacgtgaaatggaagcgatctttact
gcacaagatcctcagtttgcattaactgaagcgattaatggtaatccaccaaaaacgttg
aaagacgctaatatcaccaaaaaacattaccagttaggcttacaatttggtgtgaatggt
accccaagtattgtgaccgagaaaggcgaattgattggagggtatttaaaacccgcagat
ttattgtcggagttagcccagtaa

DBGET integrated database retrieval system