KEGG   Pasteurella multocida subsp. multocida Pm70: PM0206Help
Entry
PM0206            CDS       T00046                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PM0206 (recR)
DNA repair and recombination proteins [BR:pmu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PM0206 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
231254..231856
Genome map
AA seq 200 aa AA seqDB search
MQTSPLLEHLIESLRCLPGVGPKSAQRMAYHLLQRNRNGGMELARALTEAMSKIGHCSHC
RTFTEEEVCTICNNPRRQHSGLLCVVEQPSDIQAIEQTGQFSGRYFVLMGHLSPLDGIGP
KEIGLHLLQKRLQEESFHEVILATNPTVEGDATANYIAELCMQQNIKVTRIAHGIPVGGE
LEMVDGTTLTHSFLGRRQLG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccattactcgaacatttgatcgaaagtttacgttgtttacccggtgtt
ggaccaaaatctgctcaacgtatggcatatcacttattacaacgtaatcgtaatggaggc
atggaacttgcccgcgctttaacggaagcgatgtcaaaaatcggacattgcagccattgt
cgtacttttacggaagaagaggtgtgcacgatttgtaacaaccctcgccgtcagcattca
ggactactttgtgtggttgagcagccgtctgatattcaagctattgaacaaacaggacaa
ttttcagggcgttattttgtgttaatggggcatttatcaccattagatggaattggtcct
aaagaaattggtttgcatttattacaaaaacgcttgcaagaagaaagctttcatgaagtg
attttggctactaacccaaccgtcgaaggtgatgccacagcgaattacatcgcagagctt
tgtatgcaacaaaatattaaagtcacccgtattgcacatgggattccagtggggggggaa
ttagaaatggtggatggtacaaccttgactcattcctttttaggacgtcgccaactcggg
taa

DBGET integrated database retrieval system