KEGG   Pasteurella multocida subsp. multocida Pm70: PM0206Help
Entry
PM0206            CDS       T00046                                 

Gene name
recR
Definition
(GenBank) RecR
  KO
K06187  
recombination protein RecR
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PM0206 (recR)
DNA repair and recombination proteins [BR:pmu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     PM0206 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PM0206 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
231254..231856
Genome map
AA seq 200 aa AA seqDB search
MQTSPLLEHLIESLRCLPGVGPKSAQRMAYHLLQRNRNGGMELARALTEAMSKIGHCSHC
RTFTEEEVCTICNNPRRQHSGLLCVVEQPSDIQAIEQTGQFSGRYFVLMGHLSPLDGIGP
KEIGLHLLQKRLQEESFHEVILATNPTVEGDATANYIAELCMQQNIKVTRIAHGIPVGGE
LEMVDGTTLTHSFLGRRQLG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccattactcgaacatttgatcgaaagtttacgttgtttacccggtgtt
ggaccaaaatctgctcaacgtatggcatatcacttattacaacgtaatcgtaatggaggc
atggaacttgcccgcgctttaacggaagcgatgtcaaaaatcggacattgcagccattgt
cgtacttttacggaagaagaggtgtgcacgatttgtaacaaccctcgccgtcagcattca
ggactactttgtgtggttgagcagccgtctgatattcaagctattgaacaaacaggacaa
ttttcagggcgttattttgtgttaatggggcatttatcaccattagatggaattggtcct
aaagaaattggtttgcatttattacaaaaacgcttgcaagaagaaagctttcatgaagtg
attttggctactaacccaaccgtcgaaggtgatgccacagcgaattacatcgcagagctt
tgtatgcaacaaaatattaaagtcacccgtattgcacatgggattccagtggggggggaa
ttagaaatggtggatggtacaaccttgactcattcctttttaggacgtcgccaactcggg
taa

DBGET integrated database retrieval system