KEGG   Pasteurella multocida subsp. multocida Pm70: PM0278Help
Entry
PM0278            CDS       T00046                                 

Gene name
sucB
Definition
(GenBank) SucB
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00020  Citrate cycle (TCA cycle)
pmu00310  Lysine degradation
pmu01100  Metabolic pathways
pmu01110  Biosynthesis of secondary metabolites
pmu01120  Microbial metabolism in diverse environments
pmu01130  Biosynthesis of antibiotics
pmu01200  Carbon metabolism
Module
pmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PM0278 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PM0278 (sucB)
Enzymes [BR:pmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PM0278 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AAK02362
UniProt: Q9CNZ2
Position
317118..318332
Genome map
AA seq 404 aa AA seqDB search
MSNFEIITPDLPESVADATVVTWHKKVGDVVKRDEILVEIETDKVVLEVPAQSDGVLEAI
IEAEGATVISKQLLGKLSATAVAGGVTKETVVTQEPTPADRHHANLSTESVGSDSVSPGV
RRLIAEHDLNAEDIKGSGVGGRITREDVEKVIAQKANKAPNKPAEPAFVVGNREEKRVPM
TRLRKRIAERLLEAKNSTAMLTTFNEVDMAPIMKLRKTYGEKFEKQHGTRLGFMSFYIKA
VVEALKRYPEVNASIDGDDIIYHNYFDISIAVSTPRGLVTPVLRNCDKLSMVDIEKEIKA
LADKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPVAVNGE
VVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLEI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattttgagattataactcccgatttaccagaatctgtcgccgatgcaacggtt
gtaacttggcataagaaagtgggtgatgtcgtaaaacgtgatgagattttagtcgaaatt
gaaaccgataaagtggtacttgaagtcccagcacaatctgatggtgtacttgaagcgatt
attgaagcagaaggcgccaccgttatcagtaaacaattattaggtaaattgtcagccaca
gccgtagcgggtggtgtcactaaagaaacggttgtcactcaagagccaacgccggcggat
cgccatcatgcgaatttaagtactgaatcagtgggtagcgactcggtgagcccgggggta
cgtcgtttaattgctgagcatgacttaaatgcagaagacattaaaggaagcggtgtgggc
gggcgtattacacgcgaagatgtggagaaagttatcgcgcaaaaagccaataaagcgccg
aataagccggctgagcctgcgtttgtcgtcggtaatcgtgaagaaaaacgtgtaccaatg
acgcgtttacgcaaacgtattgcggagcgtttgttagaagcgaaaaacagcacggcaatg
ttaaccacatttaacgaagtggacatggcgccgattatgaaattacgtaaaacttatggt
gagaagtttgaaaaacaacacggcacgcgtctcggttttatgtcgttctacattaaagca
gtggtggaagcgctaaaacgttatccagaagtcaatgcgtcgattgatggtgacgatatc
atttatcataactatttcgatatcagcatcgcggtttcgacaccacgtggtttagttacc
ccagtattacgcaactgcgataaattaagtatggtggatattgaaaaagaaattaaagcg
cttgctgataaggggcgtgacggaaaattaacagttgaagatttaaccgggggtaacttt
accattactaatggtggtgtgttcggttccctcatgtctaccccgattatcaatcctcca
caaagtgccattttaggcatgcatgccattaaagatcgccctgtggcggtgaatggcgaa
gtggtgattcgtccgatgatgtatcttgcgctctcctatgatcaccgtttaattgatggt
cgtgaatcagttggtttcttagtaacgattaaagaattgttggaagatccaacccgttta
ttgttagaaatctaa

DBGET integrated database retrieval system