KEGG   Pasteurella multocida subsp. multocida Pm70: PM0439Help
Entry
PM0439            CDS       T00046                                 

Gene name
folP
Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
515215..516042
Genome map
AA seq 275 aa AA seqDB search
MKLYANNKVLDLSTPQIMGILNFTPDSFSDSGQFFALDKALFHVEKMLNAGATIIDIGGE
STRPMAEEVTLEQELDRVIPVVEAVRQNFDCWISVDTSKAEVMKEAARVGMDLINDIRAL
REPNALLTAAQLDLPVCIMHMQGEPRTMQQNPYYEDVVAEVFAFLQTRSAECISAGIRQE
NIIWDMGFGFGKTVVHNYKLLQNLAHFCAAGFPVLAGLSRKSMIGNVLDKAVEDRVVGSV
AGALIAMVHGAAIVRVHDVEHTADALKIWQATKNA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatacgcaaacaataaagtattagacttatctacgccccaaatcatggggatt
ttaaatttcacaccggattccttttcagacagtggtcaattctttgcgttagacaaagcc
ctttttcatgtggagaaaatgttaaatgctggggcaactatcatcgatattggtggtgag
tcaacgcgtcctatggcagaagaagtgacgcttgaacaagaattagatcgtgttattcct
gtggtggaagcggtgcgccagaactttgattgctggatttctgtggatacctcgaaagcg
gaagtgatgaaagaagccgctcgagtaggaatggatctgatcaatgatattcgtgcacta
cgtgagccaaatgcattactcactgcggcgcaactggatttaccagtatgtattatgcat
atgcaaggagaaccccgtactatgcagcagaatccgtattatgaggatgttgtggctgaa
gttttcgcctttttacaaacgcgttctgcagaatgtataagcgcgggtattcgacaagaa
aatattatttgggatatgggctttggttttggtaaaaccgttgtacataactataaatta
ttgcaaaacttagcgcacttttgtgctgcaggctttcccgtattagcgggcttatcccga
aaatcgatgattgggaatgtgttagataaagcggtagaagaccgtgttgttgggagtgtt
gctggtgcgttaattgcaatggtgcatggtgcagcaattgtacgtgtgcatgatgttgaa
cacacagcggatgcgctcaaaatttggcaagcaacaaagaatgcttaa

DBGET integrated database retrieval system