KEGG   Pasteurella multocida subsp. multocida Pm70: PM0517Help
Entry
PM0517            CDS       T00046                                 

Gene name
recD
Definition
(GenBank) RecD
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PM0517 (recD)
Enzymes [BR:pmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PM0517 (recD)
DNA repair and recombination proteins [BR:pmu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PM0517 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 AAA_22 DUF2075 UvrD-helicase AAA_33 AAA_29 AAA_16 UvrD_C PhoH T2SSE AAA_28 FtsK_SpoIIIE NTPase_1 NACHT AAA AAA_24
Motif
Other DBs
NCBI-ProteinID: AAK02601
UniProt: Q9CNB5
Position
593669..595642
Genome map
AA seq 657 aa AA seqDB search
MLATLKELKQHKVISEGDYYFAQLIADKQPDELPREQKNLAILLAALCSYSYQQGNTCLF
LEKGLESNYFNLAYRTAEQHYLHIIQEKIAFLPIECWQSSLADHIAFTATPLEKVAPLVF
QFNALYFYRIWQDEYRVAHYLQRAVQRGAETAPIAYEQIQAILMHYFPAVQQIEGVNWQK
VAVATALKQPFCLITGGPGTGKTTTVARLLLALQTLSACQLKIKLVAPTGKAAARLTESI
NGALTRLAQENMAISADLIASIPTTAQTLHRLLGIRFFEETPTFHPNNPLPLDVLVVDEA
SMIDLPLMAKLLQALKPNTKLILLGDENQLSPVEAGEMLGALSEFSQHAYSPALTQYLKA
VADIELISSDQGSPLRDHLCRLHHSHRFSGDSGIGQLAQAINQGNVEVSWNAFTHFNDIE
MVDFDQVALLKGDNPSLYSQACAALVVKSAVEKYTDYLVKLKALQQQSPILNEQQVGEIF
VLFNAVRFLTALRVGELGVEQLNQKIAQRLQQKGLLDFKHERDWYLGKPIMIQQNDRHIG
LYNGDIGLFLGQGKVWFEQGQGHYKTVLASRVPNYETAFVMTVHKSQGSEFAHTCLVLPT
EPNPILSRELIYTGVTRAKQQLTVFSSAEIWKSAVKNPVKRQSGLNQLLVELFNKSD
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctaccttaaaagaattaaaacaacacaaggtgatcagtgaaggggattactac
tttgcgcaattgatcgcggataagcaaccagatgaactgccgcgggaacagaaaaattta
gccatattgcttgccgcactttgtagttacagctatcaacaaggcaatacttgcttgttt
ctagagaaagggctggaatctaattattttaatttggcttatcgaacagcagagcagcat
tatcttcatattattcaagaaaaaattgcttttctaccgattgaatgttggcaatcaagc
ttggcggatcatatagcgtttacagcaacgccgctggaaaaagtcgcccctttagtgttt
cagtttaatgcgctttatttttatcgtatctggcaagatgaataccgagttgctcattat
cttcaacgtgcagtacagcggggggctgagacagcgcctattgcttatgagcaaatccaa
gcgatcttaatgcactattttcctgccgtacagcaaattgaaggggtgaattggcaaaaa
gtagcagtagcgaccgcgttaaaacaaccattttgtttgattacaggtggtccaggaaca
gggaaaaccactactgtcgcacgtttactcttggcgttacagacactttctgcgtgtcag
cttaagattaagttagttgcacctacaggcaaagcggcagcacgcttgacggagtcaatt
aatggtgcgttaacgcgtttagcacaagaaaatatggcgatcagtgccgatttaattgcc
tctattccgactacagcgcagaccttacatcgtttattgggcatacgtttttttgaagaa
acacccacttttcatccaaacaatccattgccattggatgtattggtggtcgatgaggcg
tctatgattgacttgccattaatggcgaaattattacaggcactcaaaccgaataccaaa
ttaattttgcttggagatgaaaatcaattgtctcctgtggaagcaggggaaatgttgggg
gcgttgtctgaattttctcaacacgcctatagtcctgcgttaacccagtatttaaaagca
gtggcggatattgagttaatttcgtcagatcaaggttccccgttgcgtgatcatttatgc
cgtttgcatcatagtcatcgtttttcgggggattctggaattgggcaattagcgcaggcg
attaatcaaggcaatgttgaggtaagttggaacgcatttacccattttaatgatatcgaa
atggtggattttgatcaggttgccttattaaaaggagataacccgagtttatatagccaa
gcgtgtgcagcattagtggtaaaaagtgcggttgaaaaatacacagattatttagtgaaa
ctgaaagcattacaacaacagtcacctatactgaatgaacaacaagtgggagaaattttt
gtcttgtttaatgcggttcgtttcttaacagcattacgcgttggagagctaggggtagaa
cagctaaatcagaaaatcgcgcaacgcttacaacaaaaaggcttacttgattttaaacac
gaacgcgattggtatttaggtaaaccaattatgatccagcaaaatgatcgccatattggc
ttatataatggcgacattggcttatttttaggacaaggtaaagtctggtttgagcaggga
caagggcattataaaactgtgctcgctagccgtgtgccaaactatgagaccgcgtttgtg
atgacggtacataaatcacaagggtctgagtttgcgcacacgtgtttggtattaccgacc
gaacctaacccgattttatcacgtgaattgatttatacaggcgtgacacgtgcgaaacag
caattaaccgttttttcaagtgccgaaatttggaaaagtgcggtgaaaaatccagtaaaa
agacaaagtggcttgaaccaattgttagttgaattatttaacaaatctgattag

DBGET integrated database retrieval system