KEGG   Pasteurella multocida subsp. multocida Pm70: PM0540Help
Entry
PM0540            CDS       T00046                                 

Gene name
malQ
Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pmu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
616319..618412
Genome map
AA seq 697 aa AA seqDB search
MDIAYIRREAEKQGIAPSHYDINGNLIYASQETLTYFTDLLKSSSATSEAQLHFDDVVVF
LENEPIQYALTRLPVVNQTPLSCQIMDEAGKHILTQSCIERDVITLPALEFGYYHLRITY
ENHAYSVRLLISPKTAYQPPVLQQRKAWGLNVQLYSLRSKQNWGIGDFADLAYLVEQATK
YGVDFIGINPLHLMYSAVPEWASPYSSSSRRWLNPIYLSVTTLPEFKCCKSVQHWFASDE
IQDLLEQLQATELVDYAQVMWLKQNALEQLFAFSKRSQSTSIIQRRQAFLQFMQQQGEPL
LLQGLFEVLDRQSHSNMPTEKEIGWLGWRREWQQLSPAKRQTLLKTHQAEIEFYAWLQWL
ATEQLTDIQALCHRLGMNLGIYGDLAVNSSRGSADVWTDPELYFVNASVGAPPDPLGPVG
QNWNLPPYNPAILTRRGFQPFIDMLRSNMQHFGILRIDHVMGLFRLWLIPEEKSAADGVY
VHYPFDALMAILTIESQRNRCLIVGEDLGTVPDEVRSKLNQLHIFSYFVLYFEQRNRQYP
ASEQFPVNAFATIGTHDVPSLQSFWHCVDLQLFNQLGILDGEILQQKYEQRVIDKQALLD
TLHRDGYLPPHYEGNALSMAMHAHLNYVLHQYLARSCTQLIGVQLENVLSQEISFNLPGT
DREYPNWRKKLACTLEQMFSDKHITAFLGAIDQARHA
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcatacatccggcgggaggctgaaaagcaaggcattgcgccctctcattat
gacattaatgggaatttgatttacgccagccaagagacgttaacttattttacggattta
ttgaaatcttcgtcagccacatcagaggcacaattacattttgatgatgttgtcgtgttt
cttgaaaatgaaccgattcagtatgcattaacgcgtcttcctgtggttaaccaaacgcca
ctgtcttgccaaatcatggatgaagcgggtaaacatattctgacacaatcctgtattgag
cgtgacgttatcaccttacctgcacttgagtttggttattatcatctgcggatcacttat
gaaaatcacgcttattctgtccgtttattgatcagtcctaaaacagcgtatcaaccccct
gtgttacagcaaagaaaagcatggggattgaacgttcaattatatagcttacgctcgaag
cagaattggggaattggggattttgcagacctagcgtatttagttgaacaggcgacgaag
tatggcgtggattttataggcattaatccgttgcatttgatgtatagtgcggtaccagaa
tgggcaagcccttatagctcatcttctcgtcggtggttgaaccctatttatttatctgtg
accacattgccagaatttaaatgctgtaaaagcgtgcagcattggtttgcttccgacgag
attcaagacttgcttgagcagttacaagcaacagaattagtggattatgcacaagttatg
tggttaaagcagaatgcacttgaacaattgtttgctttctcaaagcgcagtcaatcgact
tctatcattcaacgccgtcaagcctttttgcaattcatgcaacagcaaggtgaaccgtta
ttgttacaaggcttatttgaagtattagaccgtcaatcgcactcaaatatgccaacagaa
aaagagattggctggctaggttggcgtcgtgaatggcaacagttaagcccagcaaaacgc
caaacgttactcaaaacgcatcaagcagagattgagttttacgcttggttacaatggtta
gcgacagaacaattaacggatattcaagcattgtgtcatcgcctcggcatgaatttgggg
atttatggtgatttggcagttaatagttcacgcggtagtgcggatgtgtggactgatccc
gaattgtactttgtgaacgcatccgtaggggcgccgccggatcctttaggacccgttggg
caaaactggaacttacccccttataatccagcgatcttaacccgccgtggttttcaacct
tttattgatatgttgcgcagtaatatgcagcattttgggatcttgcgtattgaccatgtg
atggggttattccgtttatggttgattcccgaagaaaaaagcgcagccgatggtgtgtat
gtccattatccctttgatgcgttaatggcgattttaacgatagaaagccaacgcaatcgt
tgcttgattgtaggggaagacttgggcactgtcccagatgaagtgcggtcaaaattaaat
cagttacacattttttcttactttgtcttatattttgagcaacgtaatcgtcaatatccc
gcaagtgagcaatttccagtgaacgcttttgctaccattggcacgcatgacgtaccgtcg
ttacaaagtttctggcactgtgttgatttacaactttttaatcaactcggcattctagac
ggtgagatcttgcaacaaaaatatgaacaacgcgtgattgataaacaagcattattggac
acgttgcatcgtgatggctatttgccccctcattatgaaggaaatgccttatcaatggcg
atgcatgctcatcttaactatgtgttacaccaatatttagccagaagttgtactcaattg
attggggtacaactggaaaatgtattaagccaagaaatttcatttaatttacccggtact
gatagggaatatccaaactggcgtaaaaagctcgcatgtacacttgaacaaatgtttagt
gataagcatatcaccgcgtttttaggcgcgattgatcaagctcgtcatgcatga

DBGET integrated database retrieval system