KEGG   Pasteurella multocida subsp. multocida Pm70: PM0577Help
Entry
PM0577            CDS       T00046                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PM0577 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PM0577 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PM0577 (trpA)
Enzymes [BR:pmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PM0577 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(665139..665945)
Genome map
AA seq 268 aa AA seqDB search
MRRFDTLFSQLQQKQQGAFVPFVTLCDPNLAQSFEIIQTLVENGADALELGFPFSDPMLD
GPVIQAANQRALVAGCSTDASFQLLTQVRSTYPTLPISLLLCANLVYAQGIERFYQRCAE
VGVDAVLIADLPLFAHREFTVMAEKYSIQQVFICPPNACEDTIKRVAQQTQGYTYLVSRS
GVTGVENQQSADNLKTLVERLKAYQAPPILQGFGISQPQQVSDVLKIGVNGAISGSATVQ
IIEKYHHDPQACLAELAQFTQKMKQATT
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgttttgataccctcttttcacaattacaacaaaaacaacaaggtgcatttgtc
ccttttgtcacgctatgcgatcctaatctggcacagtcatttgagattattcaaacctta
gtggaaaatggtgcagacgccttagaattaggctttcctttttctgatccgatgttagat
ggtccagtgattcaagccgctaaccaacgtgcgttagtcgcaggttgtagcacagatgct
agttttcagttattaacacaagtacgatcaacttatccgacactaccaataagtttactg
ctttgtgccaatctggtttatgcacaaggcatcgaacgtttttatcaacgttgtgctgaa
gtgggcgtggatgcggtattaattgcggatttaccattattcgcccatcgagagtttacg
gttatggctgaaaaatatagcattcagcaggtttttatctgtccgcctaatgcctgtgaa
gacacgatcaaacgtgtcgctcaacaaacacaaggttacacctatttagtttctcgttca
ggtgtaacaggagtagaaaatcaacaatctgctgacaacttaaaaacactcgtcgagcgc
ctcaaagcctatcaagctccccctattttgcaaggctttggtatttcgcaaccacagcaa
gttagcgatgtgttaaaaataggcgtcaatggtgccatttcgggttccgctaccgttcaa
attattgaaaaatatcaccatgacccacaagcctgcttagctgaactagcgcagtttacg
caaaaaatgaaacaagcgaccacataa

DBGET integrated database retrieval system