KEGG   Pasteurella multocida subsp. multocida Pm70: PM0577Help
Entry
PM0577            CDS       T00046                                 

Gene name
trpA
Definition
(GenBank) TrpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00260  Glycine, serine and threonine metabolism
pmu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmu01100  Metabolic pathways
pmu01110  Biosynthesis of secondary metabolites
pmu01130  Biosynthesis of antibiotics
pmu01230  Biosynthesis of amino acids
Module
pmu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PM0577 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PM0577 (trpA)
Enzymes [BR:pmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PM0577 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AAK02661
UniProt: P57854
Position
complement(665139..665945)
Genome map
AA seq 268 aa AA seqDB search
MRRFDTLFSQLQQKQQGAFVPFVTLCDPNLAQSFEIIQTLVENGADALELGFPFSDPMLD
GPVIQAANQRALVAGCSTDASFQLLTQVRSTYPTLPISLLLCANLVYAQGIERFYQRCAE
VGVDAVLIADLPLFAHREFTVMAEKYSIQQVFICPPNACEDTIKRVAQQTQGYTYLVSRS
GVTGVENQQSADNLKTLVERLKAYQAPPILQGFGISQPQQVSDVLKIGVNGAISGSATVQ
IIEKYHHDPQACLAELAQFTQKMKQATT
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgttttgataccctcttttcacaattacaacaaaaacaacaaggtgcatttgtc
ccttttgtcacgctatgcgatcctaatctggcacagtcatttgagattattcaaacctta
gtggaaaatggtgcagacgccttagaattaggctttcctttttctgatccgatgttagat
ggtccagtgattcaagccgctaaccaacgtgcgttagtcgcaggttgtagcacagatgct
agttttcagttattaacacaagtacgatcaacttatccgacactaccaataagtttactg
ctttgtgccaatctggtttatgcacaaggcatcgaacgtttttatcaacgttgtgctgaa
gtgggcgtggatgcggtattaattgcggatttaccattattcgcccatcgagagtttacg
gttatggctgaaaaatatagcattcagcaggtttttatctgtccgcctaatgcctgtgaa
gacacgatcaaacgtgtcgctcaacaaacacaaggttacacctatttagtttctcgttca
ggtgtaacaggagtagaaaatcaacaatctgctgacaacttaaaaacactcgtcgagcgc
ctcaaagcctatcaagctccccctattttgcaaggctttggtatttcgcaaccacagcaa
gttagcgatgtgttaaaaataggcgtcaatggtgccatttcgggttccgctaccgttcaa
attattgaaaaatatcaccatgacccacaagcctgcttagctgaactagcgcagtttacg
caaaaaatgaaacaagcgaccacataa

DBGET integrated database retrieval system