KEGG   Pasteurella multocida subsp. multocida Pm70: PM0693Help
Entry
PM0693            CDS       T00046                                 

Gene name
folE
Definition
(GenBank) FolE
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00790  Folate biosynthesis
pmu01100  Metabolic pathways
Module
pmu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PM0693 (folE)
Enzymes [BR:pmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PM0693 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AAK02777
UniProt: P57865
Position
complement(804251..804907)
Genome map
AA seq 218 aa AA seqDB search
MNKISPEAEKVRNALLSKGIETPMITPEQDRDTRRAGIEQHMREVMKLIGLDLRDDSLEE
TPVRLAKMFVDEIFSGLDYANFPKITNIENRMKVSEMVLVNDVTLTSTCEHHFVTIDGMV
SVAYYPKKWVIGLSKINRIVAFFAQRPQVQERLTEQILLAFQTILETDDVAVYVKATHFC
VKCRGIKDTNSYTVTSAFGGVFLDDRETRKEFLTLINK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatttcaccagaagcagaaaaagtccgcaacgcattattaagtaaggggatt
gaaaccccaatgattaccccagaacaagacagagatacgcgtcgagcggggattgaacaa
catatgcgtgaagtgatgaagctgattgggttagatttacgtgatgatagtttagaagaa
acccccgtgcgtttggcgaaaatgtttgttgatgaaattttcagcggattagactatgcg
aatttcccgaaaattactaacattgaaaatcgtatgaaagtcagtgaaatggtgttggtg
aatgacgtgacgttaaccagtacttgtgaacaccattttgtgactattgatgggatggtt
tcggtggcgtattacccgaaaaaatgggtcattgggttgtctaaaattaatcgcatcgtg
gcgttttttgcacaacgtccacaagtacaagagcgtttgactgaacaaattttgttggca
ttccaaacgattttagaaacggacgatgtggcggtgtatgtaaaggctactcatttctgc
gtgaaatgccgtggcattaaagataccaacagttatacggtgacatccgcatttggtggt
gtctttttagatgaccgtgaaacgcgtaaagagtttttaaccttaattaataaataa

DBGET integrated database retrieval system