KEGG   Pasteurella multocida subsp. multocida Pm70: PM0699Help
Entry
PM0699            CDS       T00046                                 

Definition
hypothetical protein
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
813084..816215
Genome map
AA seq 1043 aa AA seqDB search
MKIQFRTLNYQLDAVQAVVNCFQGQTRHEGKRYMRDLGNTKSKHPQQIEINIPQHIDYDE
FGFANQPIDSLDNVLKNIKKIQKENNLSPSTHLIVADNQNNKNLTSSPLNIDVEMETGTG
KTYCYIRTMFELNRQYGWSKFIIVVPSIAIREGVDKSFSMMSEHFQQEYGKKARFFIYDS
KALHHLENFSADGGLNVMIINVQAFNATGKDARRIHEELDEFQSRRPIDVIAKNRPILIL
DEPQKMHADKTLTSLANFKPLFILRYSATHKRQYNLVYRLDALDAYNQKLVKKITVKGIE
VQNLSGSNSYLYLQHIEISKSAPIAKLELEIAHNNGFKLEIRKIKKGDNLFEISNEARQY
NGYVVAEIDARENAVSFTNGVKIYVGEALGDVNETTLRTIQIRETIRAHISKEKALFDRG
IKVLSLFFIDEVAKYRQYDDENNTQDGEYVRIFKTQYEQVLNELKDTSIIGSPYWDYLQN
IDIDKTHNGYFSIDKKSKRLIDPTIDSRANEVGSTSDSDAYDLILKDKERLLSFDEPTRF
IFSHSALREGWDNPNVFTICTLKHSDNVISRRQEVGRGLRLAVNKNGDRMDAKHFGENSP
EIHQLNNLTVVTNESYKEFVKNLQKEILDELSSRPTKADQQYFSGKFVRLENGEKHQISE
QQAKQIYHYLVKNDYIDDNDSLTEVYKTAQKTNQLAQLPPELSSLSSPIFQLIEGILDPD
LIERMIDNIHLKKENPINSSNLNRKEFQALWKKINRKAVFEIQLDSGSLIQESITKIEKE
AQSRGGLFVESITYKIGETTQKDNIEYSDLQIRESFGEYRTQTEKTAISVSSQVKYDLVG
EVANKTNLLRKTIVAILKGIKNGIFEQFKCNPEAFIREVSRIINEQQAKMVTQNLTYHPL
SEGYPDNEIFVSNTVPNDAYQAKHHIWEYVATDSKVETEFAKELDNASEVIVYAKLPHRF
QIPTPFGHYNPDWAIVLEKSDQKEIYFVAETKGSSDENELRLGEQNRIQSAKRFFQTLNE
EQHQNVRYDVVSCFDELMKKVLN
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcaatttagaaccttaaattaccaattagatgctgtacaagctgtagtgaat
tgctttcaagggcaaacacgccatgaaggtaaacgttatatgcgtgatttaggtaatacc
aaaagtaaacatcctcagcaaattgaaataaatattccacaacatattgactacgatgaa
tttggctttgcaaatcaacctattgacagtttagataacgtattaaaaaacattaagaaa
attcaaaaggaaaataatttatctccttcaacacatttgattgtggcagataatcagaat
aataaaaacttaacttctagtccgcttaatatcgatgtagaaatggaaactggaacaggt
aaaacctattgctatattcgtactatgtttgaactaaatagacagtatggttggtcaaaa
tttattatcgtggtgccaagtattgctattcgtgaaggtgttgataaaagcttctcaatg
atgagcgaacatttccaacaagagtatggcaaaaaagcccgtttctttatttatgattcg
aaagcattacaccatttagaaaatttcagtgcagatggtggcttaaatgtaatgattatt
aatgttcaagcatttaatgctactggaaaagatgctcgtcgtattcatgaagaattagat
gagtttcaatctcgtcgccctattgatgtgattgcgaaaaaccgccctattctaatttta
gatgaaccgcagaaaatgcatgctgataagacattaacatctttagctaattttaagcca
ctgtttattctacgttattctgctacgcataaacgacaatataacttggtttatcgtctt
gatgcacttgatgcttacaatcaaaaactggtgaaaaaaattacagtaaaaggtattgag
gtacaaaatttatctggttcaaatagttatctttatttacaacatattgaaatatctaaa
tctgcgccaattgccaaactagaactcgaaatagcccataataacggatttaagctcgaa
atccgtaaaatcaagaaaggggataacctctttgaaatcagtaatgaagcaaggcagtat
aatggttatgttgtagctgaaattgacgctcgtgaaaatgcggtaagctttactaatggt
gtaaaaatttatgttggtgaagcgttgggtgatgtgaatgaaacaacattacgtactata
caaattcgggaaacaattcgagcacacatttctaaagaaaaagccttatttgatcgtggt
atcaaagtattaagcttattttttattgatgaagtcgcaaaatatcgccaatacgatgat
gaaaataatacacaagatggtgagtacgtccgtatttttaaaacgcaatatgaacaggtt
ttgaacgaattaaaagacacatcaattataggtagtccgtattgggattatttacagaat
attgatatagataaaactcataacggctatttttctattgataaaaaatcaaaacgctta
attgatcccactatagatagtcgtgctaacgaggtcggaagcacaagtgatagcgatgcc
tatgatttaattttgaaagataaagagcgcttactttcctttgatgaaccaacgcgtttt
attttttctcactctgcgctacgcgaaggttgggataatcccaatgtatttactatttgt
acactcaaacattccgataatgttatctctcgccgtcaagaagtaggacgtggcttacgt
ttagcggtaaacaaaaacggagatcgcatggatgcaaaacattttggtgaaaatagtcca
gaaatccatcaattaaataacctcaccgtggtgaccaatgaaagttacaaagagtttgta
aaaaacctacaaaaggaaattttagatgaattgagtagtcgtccaactaaggcagatcaa
caatattttagcggtaaatttgttcgtttagaaaatggggaaaaacaccaaattagcgaa
caacaagcaaaacaaatctatcactatttagtaaaaaatgattatattgatgacaatgat
agtctcacggaggtctataaaactgctcaaaaaaccaaccaacttgctcaattaccacca
gaattaagttcactttctagtccaatttttcaattgatcgaaggaattcttgatcctgat
cttattgaaaggatgatcgataacattcatctaaaaaaagagaatccaattaattcaagc
aacttgaatcgtaaagaatttcaagcgttatggaaaaaaatcaatcgcaaagcagtcttt
gaaatacaactagacagtggaagcttaattcaagaaagtattacaaaaattgagaaagaa
gcccaatctcgtggcggtctctttgtagaaagtattacgtacaaaatcggagaaacgaca
caaaaagataatattgagtattcagatcttcaaattagagaaagttttggcgaatatcgt
actcaaacagaaaaaacagctatctcagtctcttcacaagtaaaatatgatttagttggc
gaagtcgcgaataaaacaaatttactgcgtaaaaccattgttgctattttaaaaggtatc
aaaaacggcatttttgagcagtttaaatgtaatcctgaagcctttattcgtgaggtaagt
cgtattattaatgaacagcaagccaaaatggttactcagaatctcacttaccatcctcta
tcagaaggctaccctgataatgaaatttttgtcagtaataccgtccctaatgatgcttat
caagctaaacaccatatttgggaatatgtggcaactgattcaaaagtagagaccgaattt
gccaaagaattagataatgcaagtgaagtaatcgtgtatgcaaaattacctcaccgtttt
caaattccaacgccatttggtcattacaatccagactgggctattgtgcttgaaaagtca
gatcaaaaagaaatttattttgttgctgaaaccaaaggctcaagtgatgaaaatgaattg
cgcttaggtgaacaaaatcgaatccaaagtgcaaaacgtttcttccaaacattaaatgaa
gagcaacatcaaaatgtgcgatatgacgttgtgagctgttttgatgaattaatgaagaaa
gtgctgaattag

DBGET integrated database retrieval system