KEGG   Pasteurella multocida subsp. multocida Pm70: PM0711Help
Entry
PM0711            CDS       T00046                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM0711
Enzymes [BR:pmu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PM0711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
829736..830557
Genome map
AA seq 273 aa AA seqDB search
MYHAIQPIILQQICPELRLVKYNAIPAISLQHDIGSAVIALQGAQLLSWQPKGSAHDVLW
LSEIEPFQLRKAIRGGIPLCYPWFGPVKTPSHGTARIRLWHLIDYVISTDKVRLVFGLFT
EDHLIEAKVSMDFAQDCQVRLTHYGQEDAQVALHSYFHVGDIEQIEIQGLPTHCVSNLTK
QHENVPSPRQIQQNVDCTYHITNAKTSIVDPVLQREISLEHQQASEVVLWNPWHKETSGM
SEFGYQTMVCVETARITQQLKQGEEIAVRITLK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacgctattcaaccaataattttgcaacagatttgtcctgaactccgtttagtg
aaatacaatgcaattccagccattagcttgcaacatgacattggtagcgcggtgattgcc
ttacaaggtgctcagcttctcagttggcaaccgaaaggcagtgcacacgatgtgctatgg
ctaagcgaaattgaacctttccaattacgcaaggccattcgtggcgggattccactttgc
tatccatggtttggacctgtgaaaacaccttctcatggcaccgcacgtatccgcttatgg
cacttaatcgactatgttatttcaactgataaagtgcggttagtttttggtttatttact
gaagatcatctcattgaagccaaagtcagcatggattttgctcaagattgccaagtaagg
ttgacccattatggacaagaagacgcgcaagtggcattacacagctattttcacgtcggc
gatattgaacaaatagaaatacaaggcttaccgactcactgtgtcagtaatctgacgaaa
cagcatgaaaatgtgccttctccccgccaaattcagcaaaatgtggactgtacctatcac
atcacaaatgcgaaaacgagcatcgttgaccccgttttacaacgcgagatttctcttgaa
catcaacaggctagcgaagtcgtgctatggaatccatggcacaaagaaaccagtggcatg
agtgagttcggctatcaaactatggtatgcgtagaaacagcacgtattacacagcaactc
aaacagggcgaagaaatagccgttcgtatcacgttaaaatag

DBGET integrated database retrieval system