KEGG   Pasteurella multocida subsp. multocida Pm70: PM0711Help
Entry
PM0711            CDS       T00046                                 

Definition
(GenBank) unknown
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00010  Glycolysis / Gluconeogenesis
pmu01100  Metabolic pathways
pmu01110  Biosynthesis of secondary metabolites
pmu01120  Microbial metabolism in diverse environments
pmu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM0711
Enzymes [BR:pmu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PM0711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF123
Motif
Other DBs
NCBI-ProteinID: AAK02795
UniProt: Q9CMU5
Position
829736..830557
Genome map
AA seq 273 aa AA seqDB search
MYHAIQPIILQQICPELRLVKYNAIPAISLQHDIGSAVIALQGAQLLSWQPKGSAHDVLW
LSEIEPFQLRKAIRGGIPLCYPWFGPVKTPSHGTARIRLWHLIDYVISTDKVRLVFGLFT
EDHLIEAKVSMDFAQDCQVRLTHYGQEDAQVALHSYFHVGDIEQIEIQGLPTHCVSNLTK
QHENVPSPRQIQQNVDCTYHITNAKTSIVDPVLQREISLEHQQASEVVLWNPWHKETSGM
SEFGYQTMVCVETARITQQLKQGEEIAVRITLK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacgctattcaaccaataattttgcaacagatttgtcctgaactccgtttagtg
aaatacaatgcaattccagccattagcttgcaacatgacattggtagcgcggtgattgcc
ttacaaggtgctcagcttctcagttggcaaccgaaaggcagtgcacacgatgtgctatgg
ctaagcgaaattgaacctttccaattacgcaaggccattcgtggcgggattccactttgc
tatccatggtttggacctgtgaaaacaccttctcatggcaccgcacgtatccgcttatgg
cacttaatcgactatgttatttcaactgataaagtgcggttagtttttggtttatttact
gaagatcatctcattgaagccaaagtcagcatggattttgctcaagattgccaagtaagg
ttgacccattatggacaagaagacgcgcaagtggcattacacagctattttcacgtcggc
gatattgaacaaatagaaatacaaggcttaccgactcactgtgtcagtaatctgacgaaa
cagcatgaaaatgtgccttctccccgccaaattcagcaaaatgtggactgtacctatcac
atcacaaatgcgaaaacgagcatcgttgaccccgttttacaacgcgagatttctcttgaa
catcaacaggctagcgaagtcgtgctatggaatccatggcacaaagaaaccagtggcatg
agtgagttcggctatcaaactatggtatgcgtagaaacagcacgtattacacagcaactc
aaacagggcgaagaaatagccgttcgtatcacgttaaaatag

DBGET integrated database retrieval system