KEGG   Pasteurella multocida subsp. multocida Pm70: PM0822Help
Entry
PM0822            CDS       T00046                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PM0822 (holC)
   00240 Pyrimidine metabolism
    PM0822 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PM0822 (holC)
   03430 Mismatch repair
    PM0822 (holC)
   03440 Homologous recombination
    PM0822 (holC)
Enzymes [BR:pmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PM0822 (holC)
DNA replication proteins [BR:pmu03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PM0822 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(972357..972785)
Genome map
AA seq 142 aa AA seqDB search
MSKHAQFYLLSEQAQMEKMACDFAASAWRLGKRVLIACETEQQALDIDEALWAREADEFV
PHNLSGEVTTYATPIEVSWKGKRNAQRRDLLINLQVEVPDYVSSFTQVIDFVPVEEHLKV
LARERYKQLRQLGWQLSTEQIK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacacgcgcaattttatttgttaagtgagcaagcacaaatggaaaaaatggct
tgtgattttgccgcatccgcgtggcgtcttggtaagcgcgtgttaattgcttgcgaaact
gaacaacaagcgttggatattgatgaagccttatgggcaagagaggcagatgagtttgtg
ccgcataatttatcaggtgaagtgacgacgtatgctacaccgattgaggtgagctggaaa
ggtaagcgtaatgcgcaacgccgagatctcttgattaatttacaggtagaggtaccagat
tatgtcagcagttttacacaggtgattgattttgtgccagtggaagagcatttaaaagtg
ctagccagagagcgttataaacaattacgacaacttggctggcaattatcaacagagcaa
atcaagtaa

DBGET integrated database retrieval system