KEGG   Pasteurella multocida subsp. multocida Pm70: PM0865Help
Entry
PM0865            CDS       T00046                                 

Gene name
folK
Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PM0865 (folK)
Enzymes [BR:pmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PM0865 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1018576..1019073
Genome map
AA seq 165 aa AA seqDB search
MKSVYIALGSNLQTPIAQLEAALAALANLPTTQLIHVSSFYQSKPLGPQDQPDYVNAVAH
LRTTLPPLTLLDHLQQIENTQGRVRLRRWGERTLDLDILLYDNVVCQTERLTLPHYDMTN
REFVIIPLFEIAPDLCLPSGQPLLELRKKFEDHQMQKIRTEPSLD
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctgtctatattgcattaggaagcaatttacaaacaccaattgcgcagttagag
gcggctctggcggcattagctaacttacctacaactcagttaatccatgtcagttctttt
taccaaagcaagccacttggtccacaagatcagccagactacgtaaatgcggtagcgcat
ttacgaactacgttaccgcccttaacgctccttgatcatttacagcagattgaaaataca
caaggtagagtgcgccttcgccgttggggtgaacgcactttagatctggatattttgctt
tatgataatgttgtctgtcagactgaacgcttaacccttccccactacgatatgaccaat
cgagaatttgtgatcatccctctgtttgaaattgcccctgatttatgtttaccgagtgga
caacctctgctggaattaaggaaaaaattcgaagatcaccaaatgcagaaaatacgtaca
gaacctagtcttgattag

DBGET integrated database retrieval system