KEGG   Pasteurella multocida subsp. multocida Pm70: PM0939Help
Entry
PM0939            CDS       T00046                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1108621..1110027
Genome map
AA seq 468 aa AA seqDB search
MRVKNLFFSVVAIAVASFLGTVGYVHIFDKEQSAKLLSQTPLSGQAQQVAKILYDNGCQY
CHSTNAELPFYAKFPVAESIMQEDIKKGTRVFLLNEILDGLKDPTKLSEVSLAKLEQVLI
NDEMPVAKFVHLHWGSRPDLEEKTTLLNWIREQRQNHFLPANTQGTDPTRLVQPIPDSVA
TDPLKVALGDMLYHDGRLSGDGTIQCHTCHQLKNGGVDGLDVSVGIDGLKGGINAPTVYN
SVFNILQFWDGRAKDLAEQAGGPPLNPVEMGSKNWEDIIAKFEQDEAFKAKFLAVYPAIN
EATITHAIAEFEKTLITPNSAFDRYLKGEQNALTAAQIRGYELFKQHKCDTCHVGVAMGG
QSFEYMGLFDDYFAARGTPLTEADQGRFAHTQDPADMHKFKVPTLRNIALTAPYMHDART
SDLKEAVRIMLHYQSGKTLPNKDVEDISAFLESLTGEYQGKLLTKENQ
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaaaaatctattcttttccgttgttgccattgccgttgccagctttttaggc
acagttggttatgttcatatctttgataaagaacaatccgctaaactgctatcgcaaacg
ccactaagtggacaagcacagcaagtggcaaaaatcttgtatgacaatggctgtcaatat
tgccatagtactaatgcagaattgcctttctatgctaagtttccagtagcagaaagcatt
atgcaagaagatattaaaaaaggcacacgtgtctttttgttaaatgagattcttgatggg
ttaaaagatcctactaaattgtctgaagtcagcctcgctaaattagaacaagttctgatt
aatgatgagatgcctgtcgcaaaatttgtgcatttacactggggatcacgtcctgattta
gaggaaaaaacaacgctattaaattggatacgtgagcaacgccagaatcattttctaccc
gccaatacacaaggtacagacccaacgcgtttagtccaaccgattcctgatagtgtagca
acggatccactgaaagtcgcattgggtgacatgctataccacgatggacgtctttcaggt
gatggtacaatccagtgtcatacttgccatcagttgaaaaatggtggtgtagatggtcta
gatgtttctgtcggtattgatggtcttaagggaggaattaatgccccaacagtgtataat
tccgttttcaatattttacaattctgggatggacgagcaaaagatctcgctgaacaagca
ggcggtcctcctctcaaccctgttgaaatgggctctaagaattgggaagacattatcgct
aaattcgaacaagatgaagcatttaaagccaagttcttagccgtttatcctgcgattaat
gaagccacaattacacacgccattgcggaatttgaaaaaacattgatcacaccaaacagc
gcatttgaccgttatttgaaaggcgaacaaaatgcactcacagccgcacaaatacgtggt
tatgagctcttcaaacagcacaaatgcgatacttgccatgttggtgtcgcaatgggtggg
caatcctttgagtacatgggcttatttgatgattactttgctgccagaggcacaccgcta
acagaggctgatcaaggacgctttgcacatacccaagatcctgctgatatgcataaattt
aaggtaccgactctacgtaatattgctctgactgcgccatatatgcacgatgctcgcaca
tcggatctcaaagaggccgtgcgtattatgttacattatcaaagtggtaaaacattaccg
aacaaagatgtagaagatatcagtgcattcttagaatcactcaccggtgaatatcaaggc
aagttactaaccaaagaaaatcagtaa

DBGET integrated database retrieval system