KEGG   Pasteurella multocida subsp. multocida Pm70: PM0959Help
Entry
PM0959            CDS       T00046                                 

Gene name
hold
Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PM0959 (hold)
   00240 Pyrimidine metabolism
    PM0959 (hold)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PM0959 (hold)
   03430 Mismatch repair
    PM0959 (hold)
   03440 Homologous recombination
    PM0959 (hold)
Enzymes [BR:pmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PM0959 (hold)
DNA replication proteins [BR:pmu03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PM0959 (hold)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1131801..1132211
Genome map
AA seq 136 aa AA seqDB search
MNRRDLLLQQMGITQWQLKSPTRLKGVVKINVEEKIRLIIVAEHALTTDSPLLKDILRSL
DLDESMCLCLDFERIPHLNTQYPVHYWLLSDNQEEIERLSAFCQPATAIWQSSAWSQFKH
NHHAKRQLWQQMQTTL
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaatagacgagatcttctattacaacaaatgggtatcacacaatggcagctgaagtcc
cctactcgtttgaaaggggtggtaaaaattaatgtagaagaaaaaatacgtctcatcatc
gttgccgagcacgctctcacaacagattctccattattaaaagatattttacgtagctta
gaccttgatgaaagcatgtgcttatgcttggattttgaacgtatcccacatctaaatacg
caatatcctgtccattattggctactcagcgataatcaggaagaaatcgaacgcctttcg
gctttctgtcaacccgcaaccgcaatttggcaaagtagcgcatggtcgcagtttaaacac
aaccatcatgccaaacgccaactctggcaacaaatgcaaacaacgctatga

DBGET integrated database retrieval system