KEGG   Pasteurella multocida subsp. multocida Pm70: PM0977Help
Entry
PM0977            CDS       T00046                                 

Gene name
ruvA
Definition
(GenBank) RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PM0977 (ruvA)
Enzymes [BR:pmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PM0977 (ruvA)
DNA repair and recombination proteins [BR:pmu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PM0977 (ruvA)
    RecFOR pathway proteins
     PM0977 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1148739..1149353)
Genome map
AA seq 204 aa AA seqDB search
MIGHLTGRLVEKHPPEILLDVQGVGYELLLPMTSFYQLPDIGQQTALFTHLVVREDAHLL
FGFSQKTDRTLFRELIKTNGVGPKLALAILSAMSVEEFAYAIEREELSKLVKIPGVGKKT
AERLLVELKGKFKGIQQEDFFIESQHLKQPEHALNEQDIPASEAISALIALGYKAAEAEK
LVKKISKPALSSEQLIREALKAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcatttgacgggacgtttagttgaaaaacaccctcctgagattttgttagat
gtgcaaggcgttggctacgaattattattaccgatgaccagcttttatcagcttcccgat
attggtcaacagacagctctatttactcatcttgttgtgcgtgaagatgcacatttactg
tttggtttttcgcaaaaaaccgaccgcactttgtttcgtgaattaatcaaaaccaatggt
gtaggacctaagctcgcactggctattttatcagccatgtcagtggaagagtttgcttat
gcgattgaacgtgaagaactctctaaattagtgaagattcctggggttggtaagaaaaca
gcagaacgtttattagtggaattaaaagggaagttcaaaggcattcaacaagaagacttc
tttattgaaagtcaacatcttaaacagcctgaacatgctttaaatgaacaagatatccct
gccagtgaagctatttctgcgctgattgcgttaggttataaagccgcagaagctgaaaaa
ctggtgaaaaaaatcagcaagccggcactttctagtgagcaacttatccgtgaagcatta
aaagccgccttataa

DBGET integrated database retrieval system