KEGG   Pasteurella multocida subsp. multocida Pm70: PM0977Help
Entry
PM0977            CDS       T00046                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PM0977 (ruvA)
Enzymes [BR:pmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PM0977 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1148739..1149353)
Genome map
AA seq 204 aa AA seqDB search
MIGHLTGRLVEKHPPEILLDVQGVGYELLLPMTSFYQLPDIGQQTALFTHLVVREDAHLL
FGFSQKTDRTLFRELIKTNGVGPKLALAILSAMSVEEFAYAIEREELSKLVKIPGVGKKT
AERLLVELKGKFKGIQQEDFFIESQHLKQPEHALNEQDIPASEAISALIALGYKAAEAEK
LVKKISKPALSSEQLIREALKAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcatttgacgggacgtttagttgaaaaacaccctcctgagattttgttagat
gtgcaaggcgttggctacgaattattattaccgatgaccagcttttatcagcttcccgat
attggtcaacagacagctctatttactcatcttgttgtgcgtgaagatgcacatttactg
tttggtttttcgcaaaaaaccgaccgcactttgtttcgtgaattaatcaaaaccaatggt
gtaggacctaagctcgcactggctattttatcagccatgtcagtggaagagtttgcttat
gcgattgaacgtgaagaactctctaaattagtgaagattcctggggttggtaagaaaaca
gcagaacgtttattagtggaattaaaagggaagttcaaaggcattcaacaagaagacttc
tttattgaaagtcaacatcttaaacagcctgaacatgctttaaatgaacaagatatccct
gccagtgaagctatttctgcgctgattgcgttaggttataaagccgcagaagctgaaaaa
ctggtgaaaaaaatcagcaagccggcactttctagtgagcaacttatccgtgaagcatta
aaagccgccttataa

DBGET integrated database retrieval system