KEGG   Pasteurella multocida subsp. multocida Pm70: PM1198Help
Entry
PM1198            CDS       T00046                                 

Gene name
hisD
Definition
(GenBank) HisD
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00340  Histidine metabolism
pmu01100  Metabolic pathways
pmu01110  Biosynthesis of secondary metabolites
pmu01230  Biosynthesis of amino acids
Module
pmu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    PM1198 (hisD)
Enzymes [BR:pmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PM1198 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh YpjP
Motif
Other DBs
NCBI-ProteinID: AAK03282
UniProt: Q9CLM4
Position
1392120..1393406
Genome map
AA seq 428 aa AA seqDB search
MQTLIWNTLNSAQKQAALSRPAQAVGEQITQAVNAIKSNVINNGDKALFELAEKFDKTTL
ESLVISKAQVEQASQRIATELKQAIQTAKGNIERFHQAQKNQTVDLETQAGVRCQVVTRP
IQNVGLYIPGGSAPLFSTVLMLAVPAKIAGCKTIVLCSPPPIADEILYTANLCGVETIYA
IGGAQAIFAMANGTESVQKVDKIFGPGNAFVTEAKRQVLQQGTAIDMPAGPSEVLVIADE
FADPDFVASDLLSQAEHGSDSQVILVTNCETLAKQTALSIEQQLARLPRAETARKALAHS
RTFIAEDLQQCVEISNAYAPEHLVVQVENARNLLPFLDNAGSIFLGAYSPESMGDYASGT
NHVLPTYGYTRTHSSLGLADFSKRMTVQELTPQGFKDLANTVMLMAEAEQLEAHKQAVAI
RLEKLTQE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacttatttggaatacgttaaattcagcacaaaaacaagctgcactttctcgc
ccagctcaagccgttggtgaacaaattacgcaagccgtgaatgcgatcaaaagcaatgtc
atcaacaatggggataaggcattatttgaacttgcggaaaaattcgataagaccacatta
gaaagccttgtcatctcaaaagcccaagttgagcaagcgagccagcgtattgcgacggaa
ttaaaacaagcgattcaaaccgccaaaggcaatattgaacgtttccaccaagcacaaaaa
aaccaaacggtggatctggaaacccaagccggtgtgcgttgccaagtcgttactcgcccc
attcaaaacgtcggtttatatatccccggtggctctgctccactgttttccacagtgtta
atgcttgccgtccctgccaaaattgctggctgtaaaaccattgtgctgtgttccccacca
cctattgccgatgaaattctttacaccgccaatttatgtggtgttgaaaccatttatgcc
attggaggtgctcaagccatttttgccatggcaaacggcacggaaagcgtgcagaaagtg
gataaaattttcggtccgggcaatgcctttgtcaccgaagccaaacgtcaagtattacaa
caaggcactgcgattgatatgccagccggtccctctgaagtgttagtgattgctgatgaa
tttgccgatccagattttgtcgccagcgatttactttcccaagcagaacatggctcagac
agccaagtgattttagtcactaactgtgaaacgttggcaaaacagaccgcactttccatt
gagcaacaactggctcgtttaccaagagcagaaacggctcgtaaggcacttgctcacagt
cgcacctttatcgccgaagatctgcaacaatgtgtagaaattagtaatgcttatgcgcct
gaacacttggtcgtacaggtggaaaatgcgcgtaacttactgccgtttttagataacgcc
ggctcaattttcttaggggcatattcgcctgaaagtatgggcgattatgctagtggtacc
aatcacgttctaccgacctacggctatactcgcacccattcaagtttaggtttagccgat
tttagcaaacggatgacagtacaagaactcaccccacaaggctttaaagatctcgcgaac
acggtgatgttaatggcagaagcagaacaattagaagcgcataagcaagcagtggcaatt
cgtttagagaaattaactcaggagtaa

DBGET integrated database retrieval system