KEGG   Pasteurella multocida subsp. multocida Pm70: PM1289Help
Entry
PM1289            CDS       T00046                                 

Gene name
galU
Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PM1289 (galU)
   00052 Galactose metabolism
    PM1289 (galU)
   00500 Starch and sucrose metabolism
    PM1289 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PM1289 (galU)
Enzymes [BR:pmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PM1289 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1484374..1485261
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGMKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLDEVRSICPKNVTIMHVRQGNAKGLGHAVLCGRPLVGN
EPFAVILPDVLLADFSADQKRENLAAMVKRFEETQTSQIMVAPVAEKEVSSYGIVDCGGA
DLKGGESTKIHSIVEKPSLDKAPSNLAVVGRYVFSAAIWDLLEKTPIGVGDEIQLTDAID
MLIEKEVVEAFHMTGKSFDCGDKIGYMQAFVEYGLQHDKLGQQFKTYLQQLVKSF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattatccccgtcgcaggtttagggacacgaatgttacccgcgacaaaggcg
attcctaaagaaatgttaacgctggtggataagccgttaattcaatatgttgtgaatgaa
tgcgtggctgctggtatgaaggaaattgtcttggtgacacattcttcaaaaaatgccatt
gaaaaccattttgatacctcatttgaattggagacaatgctagaaaaacgtgttaaacgt
caacttttagatgaggttcgctcgatttgtccaaaaaatgtgacaattatgcatgtccgt
caaggtaatgcgaaaggcttaggacatgccgttttatgtggcagaccattagttggaaat
gagccatttgctgtgattctaccggatgtactattggctgatttttcagcggatcaaaaa
cgtgagaatctggctgcaatggtcaaacgttttgaggaaacacaaacgagccagattatg
gttgcgcctgttgctgaaaaagaggtcagtagctacggtatcgtagattgtggcggagct
gatttaaaaggtggcgaaagtacaaaaattcatagcattgttgagaaaccgagtttagac
aaagccccttctaatttagcggtggttggacgttacgttttctcagcggcaatttgggac
ttgttggaaaaaactccgattggtgtcggcgatgaaattcaattaaccgatgcgattgat
atgttaattgaaaaagaagtcgttgaagcgttccatatgacaggaaaatctttcgattgt
ggtgataaaattggttatatgcaagcgtttgtggagtatggattgcagcatgataaatta
ggtcagcaattcaaaacgtatttgcaacagctcgtcaaaagtttttaa

DBGET integrated database retrieval system