KEGG   Pasteurella multocida subsp. multocida Pm70: PM1305Help
Entry
PM1305            CDS       T00046                                 

Gene name
kdtA
Definition
3-deoxy-D-manno-octulosonic-acid transferase
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
Lipopolysaccharide biosynthesis, KDO2-lipid A
Class
Metabolism; Glycan biosynthesis and metabolism; Lipopolysaccharide biosynthesis [PATH:pmu00540]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1499476..1500759)
Genome map
AA seq 427 aa AA seqDB search
MLRFVYTVLMYLIQPLVVLFMLGRSLKAPNYRKRLNERYGFYCGAVPPKANGVVIHAASV
GEVIAATPLIKRLQALYPTLPLTVTTVTPTGSDRVKAAFGDSVTHFYLPYDLPDAVNRFI
AFVQPKVCIVIETEIWPNLIVQLKKQAIPFIIANARLSARSTQRYHWFKGALHHIFDHIS
LIASQDNVSAQRYLSLGYDAQRLKLTGNIKYDLVLNDALMQQVASLKQAWVDQRPVWIAA
STHEGEEDLILETHRLLLHKYPNLLLILVPRHPERFNMVAELIKKHKLTYVRRSDHVTPD
GSTQVVLGDTMGELMLMYGLADIAFVGGSLVKHGGHNPLEPLAFKLPVISGKYTFNFPEV
FTKLLQVQGVLEVNENTKALTNAVEKFLDSQELRERYGNAGYEVLIENRGALQRLLDLLD
PYLSKTV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtttcgtctataccgtcttaatgtatttgattcaacctttggttgtcttattt
atgctaggacgtagcttaaaagccccaaattaccgtaaacgccttaatgaacgttatggc
ttttattgtggtgcagtgccaccaaaagcaaatggtgttgtcatccatgcggcctctgtg
ggcgaggttattgcggcaacgccactgattaagcgtctgcaagccctttatccgacgtta
cccctgacagtcaccacggtgacccccaccggctctgatcgagtgaaggccgcctttggc
gacagtgttactcacttttacttaccttacgatttaccggatgccgttaaccgttttatt
gcctttgtgcaaccgaaagtctgtattgtgattgaaactgaaatttggcccaatttaatt
gtgcaactcaaaaaacaagccattccgtttattattgctaatgcgcgtttatccgcacgt
tcaacacagcgttatcactggttcaaaggcgcactacatcacatttttgatcacatcagt
ctaattgcatcacaagataacgtcagtgctcaacgttatttatcgctcggttatgatgcg
caacgtttaaaattaactggcaacatcaaatatgatttagtactcaacgatgcgctgatg
caacaagttgcgtcactcaaacaggcttgggttgatcaacgcccggtgtggatcgcggca
agtacacatgagggagaagaagatcttatcttagaaactcatcgtctcttactacataaa
tacccaaatctattgttaattcttgtccctcgtcatccagaacgctttaatatggtggcg
gaattaattaaaaaacataaattgacttacgttcgtcgtagcgatcatgttacgcccgat
ggctcaactcaagttgtacttggtgataccatgggtgagctgatgttgatgtatgggctt
gccgatattgcttttgtgggaggcagtttggttaagcatgggggacataatccactcgaa
ccacttgcctttaaattacctgtcatcagtggtaaatacacctttaacttccctgaagtg
tttacaaaactgttgcaagtacaaggcgtattagaagtgaatgaaaacaccaaagccctg
accaatgcagtcgaaaaatttttagattcacaagaattacgtgagcgttatggcaatgcg
ggttatgaagtcctgattgaaaatcgtggcgccttacaacgtttgttagatttattagat
ccttatttaagtaaaacagtatga

DBGET integrated database retrieval system