KEGG   Pasteurella multocida subsp. multocida Pm70: PM1311Help
Entry
PM1311            CDS       T00046                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PM1311 (tpiA)
   01230 Biosynthesis of amino acids
    PM1311 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM1311 (tpiA)
   00051 Fructose and mannose metabolism
    PM1311 (tpiA)
   00562 Inositol phosphate metabolism
    PM1311 (tpiA)
Enzymes [BR:pmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PM1311 (tpiA)
Exosome [BR:pmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PM1311 (tpiA)
  Exosomal proteins of bladder cancer cells
   PM1311 (tpiA)
  Exosomal proteins of melanoma cells
   PM1311 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1505418..1506203)
Genome map
AA seq 261 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKALIEDLKTELAGVEGCDVAIAPPVMYLAEAEAALKCSCS
CGGKAIALGAQNVDVNVQGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFIAKKF
AALKQAGLVPVLCIGESEAENEAGKTEEVCARQIDAVLNTLGAEAFNGAVIAYEPIWAIG
TGKSATPAQAQAVHAFIRGHIAKKDNAVAEQVIIQYGGSVNDANAAELFTQPDIDGALVG
GASLKAPAFAVIVKAAAKAKN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcattcacc
aaagcattaatcgaagacttaaaaacagaattagcgggtgttgaaggctgcgatgtggca
attgccccaccggtgatgtatttagcagaagcagaagctgccttaaaatgcagttgtagt
tgtggcggaaaagccattgcccttggtgcacaaaacgtcgatgtgaatgtacaaggtgcc
tttactggcgatatttcaacagaaatgctgaaagattttggtgcaaaatatatcattatc
ggtcactctgagcgtcgtacttatcataaagaaagcgatgaattcatcgcgaaaaaattc
gcagcattaaaacaagcaggcttagtgccggtattgtgtatcggtgaaagtgaagccgaa
aatgaagcgggcaaaacagaagaagtatgcgcacgccaaattgatgccgtattaaataca
ttaggcgctgaagcctttaatggtgccgttatcgcttatgagccaatttgggcaatcggt
accggtaaatcagcaacccctgctcaagcacaagcagttcatgcctttatccgcggtcat
attgcgaaaaaagacaacgcggtagcagaacaagtgatcatccaatacggtggttcagtt
aatgatgcgaatgcggctgaattatttactcaacccgatatcgatggtgcattagttggt
ggtgcctcattaaaagctcctgcctttgcggtgatcgtcaaagccgcagcaaaagcaaaa
aactaa

DBGET integrated database retrieval system