KEGG   Pasteurella multocida subsp. multocida Pm70: PM1381Help
Entry
PM1381            CDS       T00046                                 

Gene name
speE
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pmu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1575615..1576535)
Genome map
AA seq 306 aa AA seqDB search
MYNTLNNKEDISLVSNNFGFLRLPVHFNPVETDAEWVITGVPFDASVSGRAGTRFGAEAI
RRASVNLAWEHCRFPWDFDVRERLKIVDCGDLVYSFGDNQNFVEELEAHATALLKAGKRC
LTFGGDHFITLPLLRAHAKHFGKLAMIHFDAHTDTYENGSRYDHGTMFYHAPNEGLIDAA
HSVQIGIRTEFDRNLPFTVLSAPQVNEESVAQTVAKIKEVIGDLPVYLTFDIDCLDPAYA
PGTGTPVCGGLSTDRALKILRALKDVNIVGMDLVEVSPAYDQSDITALAGATLALEMLYM
QGAKKG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtacaatacgttaaacaataaagaagatatttcattagtttcaaataattttggtttt
ctacgcttgcctgttcactttaatcccgtcgaaacggatgcagagtgggttattactggc
gtaccgtttgatgcgtcagtatcgggtcgcgcaggaacgcgttttggtgcggaagccatt
cgtcgcgcgtcggtgaatttggcttgggaacactgtcgctttccatgggattttgatgtg
cgtgagcgtttaaagatcgtggattgtggcgatttggtttattcattcggtgataatcaa
aatttcgtagaagaattagaagcgcacgcaaccgctttattaaaagcgggtaagcgttgc
ttaacttttggtggcgatcatttcattaccttgcctttattacgtgcccatgcaaaacat
tttggtaagttggcgatgattcactttgatgcccatacggatacctatgaaaatggcagt
cgttatgatcacggtaccatgttttaccatgcgccaaacgaagggttaattgatgcagcc
cattcggtacaaattggtattcgtactgaatttgatcgcaacttaccatttacggtactt
tctgcgccacaagtcaacgaggagagcgtggcacaaactgttgctaaaatcaaagaggta
attggtgatttacctgtctatttaacctttgatatcgattgtttagatcctgcttatgca
ccgggtaccggtacgccagtctgtggtggattaagcacagacagagcattgaaaatttta
cgtgccttgaaagatgtgaatattgtgggtatggatttggttgaagtctctcctgcctat
gatcaatcggacattactgctttagcaggtgcgacgttggcgctagaaatgctgtatatg
caaggggcgaaaaaaggctaa

DBGET integrated database retrieval system