KEGG   Pasteurella multocida subsp. multocida Pm70: PM1426Help
Entry
PM1426            CDS       T00046                                 

Definition
phospholipase A (EC:3.1.1.32 3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PM1426
   00565 Ether lipid metabolism
    PM1426
   00590 Arachidonic acid metabolism
    PM1426
   00591 Linoleic acid metabolism
    PM1426
   00592 alpha-Linolenic acid metabolism
    PM1426
Enzymes [BR:pmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     PM1426
    3.1.1.32  phospholipase A1
     PM1426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1609960..1610880
Genome map
AA seq 306 aa AA seqDB search
MPLMVKLFTLVKEVIRMYKAKGINLYKKCLILAVLGVFVSHGTQANESDARPYKSKAEVL
LTKSDAFIGLLGYEENYLMGTYSNRHFLKREKTQKDEIKFKISLALPLWRGILGNNSVLA
ASYTQKSWFQLSNVDDSSPFRETNYEPQLFLAWKTQYSLPFGWTLQDVETGINHQSNGRD
DAEKLSRSWNRLYVRASAIKQNWTVEIKPWWRIPEKAKNDDNPDITKYRGHFDVALGYYY
HDHQFKLSGHYNPISNKGGLEASYSYPITKNIRFYTQYYNGYGESLIDYQQRIQRIGIGI
SLNNVF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctcatggtgaaattgttcactttagttaaggaagtaatcagaatgtacaaagca
aaaggaattaacctgtacaaaaaatgccttatcttagcagtgttaggcgtctttgttagc
catggtacacaggcaaatgaaagtgacgcgcgtccctataaaagtaaagcagaagtctta
ttaactaaatctgatgccttcatcggcttacttggctacgaagaaaactatctgatgggg
acttattcaaacaggcattttcttaaacgcgaaaaaacgcaaaaagatgagattaagttc
aaaattagcttagcacttcccctttggcggggtattttgggcaataactccgtattagcc
gcttcttatacacaaaagtcctggtttcagctaagtaatgttgatgattcttctcctttc
cgcgaaaccaattacgaacctcagctatttttggcttggaaaacgcaatattccttacct
tttggctggacattacaggatgtggaaaccgggataaatcatcaatccaatgggcgcgat
gatgcggaaaaactctctcgcagttggaatcgcctctatgtgcgtgcctctgccataaaa
cagaattggacagttgaaatcaaaccttggtggcgtattcctgagaaagccaaaaatgat
gataacccagacatcactaaataccgcggtcattttgatgtagcgttggggtactactat
cacgatcatcaatttaaactttcaggtcactataatccgatctcaaacaaagggggatta
gaggcaagttatagttacccaatcacaaaaaacattcgtttctacactcaatactataat
ggctatggtgaatccttaattgattatcaacaacgtatccaacgtattggtatcggcatt
tccttgaacaatgttttctag

  All links  
No link information was found.   
DBGET integrated database retrieval system