KEGG   Pasteurella multocida subsp. multocida Pm70: PM1426Help
Entry
PM1426            CDS       T00046                                 

Definition
phospholipase A (EC:3.1.1.32 3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pmu00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:pmu00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:pmu00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1609960..1610880
Genome map
AA seq 306 aa AA seqDB search
MPLMVKLFTLVKEVIRMYKAKGINLYKKCLILAVLGVFVSHGTQANESDARPYKSKAEVL
LTKSDAFIGLLGYEENYLMGTYSNRHFLKREKTQKDEIKFKISLALPLWRGILGNNSVLA
ASYTQKSWFQLSNVDDSSPFRETNYEPQLFLAWKTQYSLPFGWTLQDVETGINHQSNGRD
DAEKLSRSWNRLYVRASAIKQNWTVEIKPWWRIPEKAKNDDNPDITKYRGHFDVALGYYY
HDHQFKLSGHYNPISNKGGLEASYSYPITKNIRFYTQYYNGYGESLIDYQQRIQRIGIGI
SLNNVF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctcatggtgaaattgttcactttagttaaggaagtaatcagaatgtacaaagca
aaaggaattaacctgtacaaaaaatgccttatcttagcagtgttaggcgtctttgttagc
catggtacacaggcaaatgaaagtgacgcgcgtccctataaaagtaaagcagaagtctta
ttaactaaatctgatgccttcatcggcttacttggctacgaagaaaactatctgatgggg
acttattcaaacaggcattttcttaaacgcgaaaaaacgcaaaaagatgagattaagttc
aaaattagcttagcacttcccctttggcggggtattttgggcaataactccgtattagcc
gcttcttatacacaaaagtcctggtttcagctaagtaatgttgatgattcttctcctttc
cgcgaaaccaattacgaacctcagctatttttggcttggaaaacgcaatattccttacct
tttggctggacattacaggatgtggaaaccgggataaatcatcaatccaatgggcgcgat
gatgcggaaaaactctctcgcagttggaatcgcctctatgtgcgtgcctctgccataaaa
cagaattggacagttgaaatcaaaccttggtggcgtattcctgagaaagccaaaaatgat
gataacccagacatcactaaataccgcggtcattttgatgtagcgttggggtactactat
cacgatcatcaatttaaactttcaggtcactataatccgatctcaaacaaagggggatta
gaggcaagttatagttacccaatcacaaaaaacattcgtttctacactcaatactataat
ggctatggtgaatccttaattgattatcaacaacgtatccaacgtattggtatcggcatt
tccttgaacaatgttttctag

DBGET integrated database retrieval system