KEGG   Pasteurella multocida subsp. multocida Pm70: PM1453Help
Entry
PM1453            CDS       T00046                                 

Gene name
adh2
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PM1453 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM1453 (adh2)
   00620 Pyruvate metabolism
    PM1453 (adh2)
   00650 Butanoate metabolism
    PM1453 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    PM1453 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PM1453 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PM1453 (adh2)
   00626 Naphthalene degradation
    PM1453 (adh2)
Enzymes [BR:pmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PM1453 (adh2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PM1453 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1640533..1643160
Genome map
AA seq 875 aa AA seqDB search
MMSHTAEIEISPAQAEVNVLVEKGLLALEAFRQLNQQQVDYIVAKASVAALDQHGVLAMH
AYEETGRGVFEDKATKNLFACEYVVNNMRNLKTVGVISEDDVTGITEIADPVGVVCGITP
TTNPTSTTIFKALISLKTRNPIVFAFHPSAQQCSAHAARVVYEAAVAAGAPEHCIQWIET
PSMEGTAALMKHPGIATILATGGNAMVEAAYSCGKPALGVGAGNVPAYVEKSANIKQATH
DIVMSKAFDNGMICASEQAAIVDQEVYDEFVAEMQSYGAYFVNKKEKALLETFLFGVKAN
STNCANAKLNAAVVGKPATWIAEQAGFKVPEKTNILVAACQEVGENEPLTREKLSPVLAI
LKSTSTEHGFALSEAMVNFHGLGHSAAIHTKEASIAKAFGERVKAIRVIWNSPATFGGIG
DVYNAFLPSLTLGCGSYGKNSVGNNVSAANLLNIKRVGRRRNNMQWFKVPSKIYFERDSI
QYLQSMKGMERVVIVTDRTMVDLGFVEKIAKQITARGNHVTYQLFADVEPDPSIETVRRG
AALIRNYQPDTIIALGGGSAMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPQLGR
KARFIGIPTTSGTGSEVTPFAVITEGDKKYPIADYSLTPTVAIVDPAFVMSVPAHVAADT
GLDVLTHATEAYVSVLANDFTDGLALQAIKLVFEHLERSVKDKDPEAREKMHNASTMAGM
AFANAFLGMNHSLAHKIGGRFHTPHGRTNAVLMPHVIRYNGTRPQKTATWPKYNYYKADV
KYQDIARMLGLPCATPEEGVKSFAQACYDLAIRVGIKMSFKEQGIDEKEWMDARRQVALL
AFEDQCSPANPRLPVVSDMEVILTNAYYGYDANQY
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtcatactgctgaaattgaaatcagcccagcacaagcagaagtgaatgtactg
gttgaaaaaggattgctggcattagaagcattccgtcagcttaatcaacagcaagtggat
tacattgtggcaaaagcctcagtagctgctttagatcaacatggggtgcttgctatgcat
gcttatgaagaaacagggcgcggggtatttgaagataaagccaccaaaaatctgtttgcc
tgtgaatatgtagtcaacaatatgcggaatttgaaaaccgtgggggtgatcagtgaggat
gatgtcacagggatcaccgaaattgcagaccctgttggcgtggtttgcggaattacccca
acgaccaacccgacgtccaccaccattttcaaagcccttatctcgctaaaaacccgtaac
cccatcgtctttgcattccatccttccgcacaacaatgttctgctcatgcggcacgcgta
gtctatgaggcagccgttgcagcgggggcgccagaacattgtattcaatggattgaaacc
ccgtcgatggaaggcaccgcagcgctgatgaaacacccaggcattgctaccattcttgct
acgggcggcaatgcgatggttgaggcggcgtattcttgtggtaaaccagctcttggcgta
ggagcgggtaacgtacctgcttatgtggaaaaaagcgcaaatatcaaacaagctacacat
gatattgtgatgtcaaaagcctttgataacggcatgatttgtgcctctgaacaagccgcc
attgtcgatcaagaggtgtacgatgaatttgtggcagaaatgcagtcttatggtgcttac
tttgtaaataaaaaagaaaaagccttgttagaaacatttcttttcggcgtcaaagccaac
agtacaaattgtgctaacgcaaaattaaatgccgcggttgtgggaaaacctgccacatgg
atcgccgaacaagcgggcttcaaagtgccagaaaaaaccaatattttggtggcagcctgt
caagaagtgggcgaaaacgaaccccttacccgtgaaaaactttccccagtcctcgcgata
ttaaaatccacgtcaacagaacatggctttgcgttatctgaagccatggtgaatttccat
ggtttaggacattccgccgccattcatactaaagaggcaagcattgccaaagcctttggc
gaacgcgtgaaagccattcgtgtgatctggaactcgcctgcgacctttgggggcattggc
gatgtgtataatgccttcctcccgtcactcacactcggttgtggttcctacgggaaaaac
tccgtcggtaacaatgtcagtgcagccaatttattaaatattaaacgtgtgggaagacgg
agaaataacatgcaatggttcaaagtgccttcaaaaatctattttgaacgcgattcaatt
caatatttacaatcaatgaaaggcatggaacgcgtggtgattgtcactgacagaaccatg
gtggatctaggctttgtggaaaaaattgctaaacaaattaccgcgcgtggtaaccatgtg
acctaccaattgtttgctgatgtagaaccggatccatctatcgaaacggtacgccgtggc
gcagcattaattcgcaactaccaacccgatacgattattgcgttaggtggtggatcggca
atggatgcagcaaaagtcatgtggttgttctatgaacaacctgaagtggatttccgtgat
ttagtccaaaaattcatggatattcgcaaacgggcgttcaaattcccacaattagggcgc
aaagcgcgctttatcggcattccaacgacttcaggcacaggttcagaagtcacgccattt
gcggtcatcaccgaaggcgataaaaaatacccgatcgctgactactcgctcaccccaaca
gtcgccattgtggatccggcttttgtgatgagtgtgccggcacatgttgctgcggatacc
ggactagacgtgttaacccatgccacggaagcttatgtgtcagtgctcgccaacgacttt
accgacggtttagccctacaagcgatcaagctcgtgtttgaacatttagaacgctccgtg
aaagacaaagatcccgaagcgcgtgaaaaaatgcacaatgcgtccaccatggcagggatg
gcatttgctaacgccttcttgggcatgaaccattcccttgcacacaaaattggcgggcgt
ttccacactccacatggtcgtaccaatgcggtcttaatgccacatgtgattcgttataac
ggcacacgtccacaaaaaacggcaacgtggccaaaatacaattactacaaagcggatgtg
aaataccaagatatcgcgcgtatgctcggtttaccttgtgccacaccagaagaaggggtg
aaatcctttgcacaagcgtgctatgacttagccattcgcgtgggtatcaagatgtccttc
aaagagcaaggtattgatgaaaaagaatggatggacgctcgtcgccaagtcgcgttactc
gcctttgaagaccaatgttcgccagccaacccacgtttacctgtggtaagcgatatggag
gtgatcttaaccaatgcctactatggttatgatgccaatcaatactga

DBGET integrated database retrieval system