KEGG   Pasteurella multocida subsp. multocida Pm70: PM1506Help
Entry
PM1506            CDS       T00046                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PM1506 (gpmA)
   01230 Biosynthesis of amino acids
    PM1506 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM1506 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    PM1506 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PM1506 (gpmA)
Enzymes [BR:pmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PM1506 (gpmA)
Exosome [BR:pmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PM1506 (gpmA)
  Exosomal proteins of melanoma cells
   PM1506 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1704487..1705170)
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGIEEAKSAGKKLLEAGFEFDIAFTSVLTRA
IKTCNIVLEESNQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISP
PDLDPQDPHSAHNDRRYAHLPSDVVPDAENLKITLERVLPFWEDQIAPALLAGKRVLVTA
HGNSLRALAKHIEGISDADIMDLEIPTGQPLVYKLDDNLKVVEKYYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattggtctttattcgccacggtttcagtgagtggaatgccaaaaacctattcaca
ggttggcgtgatgtcaacttaacagaacgcggtatcgaagaagcaaaatcagcaggcaaa
aaattactcgaagccggttttgaatttgatattgctttcacgtctgttttaacgcgtgca
attaaaacctgtaacattgtgttagaagaatctaaccaactttggatcccacaagtgaaa
aactggcgtttaaatgagcgtcattacggtgcattacaaggcttagataaaaaagccact
gcagaacaatatggtgatgagcaagtccatatttggcgtcgttcttacgatatttctcct
ccagatttagatccacaagatcctcattctgcccataacgaccgtcgttatgctcactta
ccaagcgatgtggtacctgatgcagaaaacttaaaaatcacccttgagcgtgttttacct
ttctgggaagaccaaattgccccagctttactggcgggtaaacgtgtccttgtgacagca
cacggcaactcattacgtgcattggcaaaacacattgaaggcatttctgatgcagacatc
atggatttagaaatcccaaccggtcagccattagtgtacaaattagatgacaatttaaaa
gtcgtggaaaaatactacctttaa

DBGET integrated database retrieval system