KEGG   Pasteurella multocida subsp. multocida Pm70: PM1506Help
Entry
PM1506            CDS       T00046                                 

Gene name
gpmA
Definition
(GenBank) GpmA
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00010  Glycolysis / Gluconeogenesis
pmu00260  Glycine, serine and threonine metabolism
pmu00680  Methane metabolism
pmu01100  Metabolic pathways
pmu01110  Biosynthesis of secondary metabolites
pmu01120  Microbial metabolism in diverse environments
pmu01130  Biosynthesis of antibiotics
pmu01200  Carbon metabolism
pmu01230  Biosynthesis of amino acids
Module
pmu_M00002  Glycolysis, core module involving three-carbon compounds
pmu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM1506 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    PM1506 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PM1506 (gpmA)
Enzymes [BR:pmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PM1506 (gpmA)
Membrane trafficking [BR:pmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PM1506 (gpmA)
Exosome [BR:pmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PM1506 (gpmA)
  Exosomal proteins of melanoma cells
   PM1506 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAK03590
UniProt: Q9CKU9
Position
complement(1704487..1705170)
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGIEEAKSAGKKLLEAGFEFDIAFTSVLTRA
IKTCNIVLEESNQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISP
PDLDPQDPHSAHNDRRYAHLPSDVVPDAENLKITLERVLPFWEDQIAPALLAGKRVLVTA
HGNSLRALAKHIEGISDADIMDLEIPTGQPLVYKLDDNLKVVEKYYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattggtctttattcgccacggtttcagtgagtggaatgccaaaaacctattcaca
ggttggcgtgatgtcaacttaacagaacgcggtatcgaagaagcaaaatcagcaggcaaa
aaattactcgaagccggttttgaatttgatattgctttcacgtctgttttaacgcgtgca
attaaaacctgtaacattgtgttagaagaatctaaccaactttggatcccacaagtgaaa
aactggcgtttaaatgagcgtcattacggtgcattacaaggcttagataaaaaagccact
gcagaacaatatggtgatgagcaagtccatatttggcgtcgttcttacgatatttctcct
ccagatttagatccacaagatcctcattctgcccataacgaccgtcgttatgctcactta
ccaagcgatgtggtacctgatgcagaaaacttaaaaatcacccttgagcgtgttttacct
ttctgggaagaccaaattgccccagctttactggcgggtaaacgtgtccttgtgacagca
cacggcaactcattacgtgcattggcaaaacacattgaaggcatttctgatgcagacatc
atggatttagaaatcccaaccggtcagccattagtgtacaaattagatgacaatttaaaa
gtcgtggaaaaatactacctttaa

DBGET integrated database retrieval system