KEGG   Pasteurella multocida subsp. multocida Pm70: PM1631Help
Entry
PM1631            CDS       T00046                                 

Gene name
pldB
Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PM1631 (pldB)
Enzymes [BR:pmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PM1631 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1841661..1842614)
Genome map
AA seq 317 aa AA seqDB search
MIREPHFTHFALAELHPFAAQFPLQDVQGKKGVRITYRHFVQDNPVQRNLVILVNGRAEN
LLKWTELAYDFYQQGYDVLVFDHRGQGYSQRLLPDHEKGYIDEFRFYADDMAILLAKISA
LYPYENQHILAHSLGALISTYYLANYDHQVKSAVFSAPFYGIPLKHSFRDELIINLMMLL
GQGSRYVFGKGRYQPADLDNNDLSCCRTRMRWMNRINRRYPHIHLGGPTFRWVHLCFSAI
KKLPTILPRIEIPVLILQSEKEKIVENKNLRKLTALLPRGELTQIAQSKHEILFERDLIR
SEALKKISQFFTANSAK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtgaaccccattttactcactttgccttggctgaattacatccttttgcagca
caatttccgttgcaagacgtacaagggaaaaaaggggtacgtattacctatcggcatttt
gtacaagacaatcccgtacagcgtaatttggtgattttagtcaatggacgtgcagaaaac
ttattgaaatggactgaactggcttatgatttctatcaacaaggctacgacgtcttggta
tttgatcatcgtgggcaaggctattcacagcgtttattgccagatcatgagaaaggttat
attgatgagtttcgtttttatgcggacgatatggcgattttattagcgaaaatcagcgca
ctttatccttatgaaaatcaacatattctcgcccattccttaggtgcattgattagtact
tattaccttgccaattacgatcatcaggtgaaaagtgcggtcttttctgcgccattttat
ggcattcctctcaaacattctttccgagatgagctcattattaatctaatgatgttatta
ggtcagggttcacgctatgtgtttggcaaaggacgttatcaaccggcggatttggataat
aatgatttaagttgttgtcgaactcgtatgcgctggatgaatcgaattaatcgtcggtat
ccgcatattcatttagggggaccgaccttccgttgggtgcatttatgttttagtgccatt
aaaaaattaccgactattttgccgcgtattgagattcctgtgctgattctacaatcggag
aaagaaaagattgtggaaaataaaaatctgcgcaaactcaccgcacttttaccacgagga
gagttaacacaaattgcgcaaagtaaacacgaaattttatttgagcgtgatcttatccgc
tccgaggcactcaagaaaattagccaattttttactgccaatagcgccaaataa

DBGET integrated database retrieval system