KEGG   Pasteurella multocida subsp. multocida Pm70: PM1692Help
Entry
PM1692            CDS       T00046                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pmu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1900218..1901243
Genome map
AA seq 341 aa AA seqDB search
MTQQIFANFPQRRLRRMRKQAFSRRLMAENKLSVEDLIYPVFIIEGEKQREPVPSMPGVE
RLTIDELLIEAELLVKYGVPVIALFPVIAQEKKSLMAEEAYHPDGLVQRAVKALKDKFPT
ELGILTDIALDPYTTHGQDGIIDQHGYVLNDVTSDILVKQALSHAKAGADIVAPSDMMDG
RIGKIRHALEEKGFINTLIMAYSAKYASHYYGPFRDAVGSATNLKGGDKKTYQLDPANSD
EGLQEVALDLQEGADMVMVKPGMPYLDLVYRVKTHFGVPTFAYQVSGEYAMHQAAIQNGW
LKEKECIMESLLCFKRAGADGILTYYAKQVAEWLYWEKQHQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaaatttttgccaatttccctcaacgtcgcctacgccgtatgcggaaacaa
gctttcagtcgccgtttaatggcagaaaataaactcagcgtagaggatttaatttatccc
gtttttattattgaaggcgaaaagcaaagggaacccgtaccttccatgcctggtgtagaa
cgcttaaccattgatgagctattaattgaagccgaacttttagtcaaatatggggtaccg
gtgattgcgcttttcccggtgattgcacaagagaaaaaatccttaatggcagaagaagct
tatcatcctgatggcttagtacagcgcgcggtaaaagcgttaaaggacaaattcccaact
gaacttggcatacttactgatattgccctcgatccctatactacacacggacaagacggg
ataattgatcaacatggctatgtgttaaatgatgtcactagcgatattttggtcaaacaa
gcgctttcccatgcgaaagcgggcgcagatattgtagcaccaagcgatatgatggacggt
agaattggcaaaattcgccatgccctcgaggaaaaggggtttatcaatacactcattatg
gcgtattctgccaaatatgcttctcattattatggacctttccgcgatgccgtcggttct
gccaccaatttaaaagggggcgataaaaaaacttatcaattagatccggccaatagtgat
gaaggactacaagaagtggcattagatttacaagaaggggcagatatggtgatggtcaaa
cccggcatgccgtatttagatttagtttatcgcgtgaaaacccattttggcgtgccaact
ttcgcttaccaagtatcgggtgagtatgccatgcatcaagctgcgatccaaaacggctgg
ctcaaagaaaaagaatgtattatggaatctttattgtgcttcaaacgtgctggcgccgat
gggattttgacgtattacgccaaacaagtagcagaatggctatattgggaaaaacaacat
caataa

DBGET integrated database retrieval system