KEGG   Pasteurella multocida subsp. multocida Pm70: PM1813Help
Entry
PM1813            CDS       T00046                                 

Gene name
hemX
Definition
(GenBank) HemX
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00860  Porphyrin and chlorophyll metabolism
pmu01100  Metabolic pathways
pmu01110  Biosynthesis of secondary metabolites
pmu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PM1813 (hemX)
Enzymes [BR:pmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PM1813 (hemX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AAK03897
UniProt: Q9CK23
Position
2042885..2043631
Genome map
AA seq 248 aa AA seqDB search
MAVLVTRPDVRGAQLTEMLIQAGIFAIHLPLFTIETGRELNDLPNKLSQLKAGDYVFAVS
KHAVQYAVDTLKNTGFSWRTDLAYFAVGQRSAEFFASQIERAVLYPYRQESSEGLLALDA
MQDLSEKHILILRGNGGREYFSEQAQLRGAKVETLECYQRVPTAYNNAEQISICKRAGIN
RLVISSAEILQYLVDFVPESEHNWLKSCQLVTVSQRIANLAKQLGWCDVVVSPRADNVHL
LKTLLSAD
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcggtattagtcactcgacctgatgtgcgaggcgcacagttaacagagatgttgatt
caagcggggatttttgcaatccatttaccgctctttacgatcgaaacaggacgagaattg
aatgacttgccgaataaactgtcgcaacttaaagcgggtgattatgtttttgcagtttca
aaacatgctgttcagtatgcagtcgatacgttaaagaatacagggttttcttggcgaaca
gatttagcctattttgcggtaggacagcgcagtgctgaattttttgccagtcaaatcgaa
cgtgcggtattgtatccttatcgacaggaaagtagcgaaggattattagcactggatgcc
atgcaagatttgtcagaaaagcacattttaattttacgcggcaatgggggacgtgagtat
ttttctgaacaggcacaattgcgtggtgctaaagtggagacgctcgaatgttaccagcgt
gtaccgactgcctacaataatgcagagcagatcagtatttgtaagcgtgcaggaattaat
cggcttgtgattagcagtgcagaaattttgcagtatcttgtggattttgttccagaaagc
gaacataattggctaaaaagttgtcagctggtgacggtaagtcagcgtattgccaattta
gccaaacaattgggttggtgtgatgtggtggtttcaccgcgagcagataacgtgcattta
ctaaaaacattgctgtctgcggactaa

DBGET integrated database retrieval system