KEGG   Pasteurella multocida subsp. multocida Pm70: PM1813Help
Entry
PM1813            CDS       T00046                                 

Gene name
hemX
Definition
protein HemX
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PM1813 (hemX)
Enzymes [BR:pmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PM1813 (hemX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2042885..2043631
Genome map
AA seq 248 aa AA seqDB search
MAVLVTRPDVRGAQLTEMLIQAGIFAIHLPLFTIETGRELNDLPNKLSQLKAGDYVFAVS
KHAVQYAVDTLKNTGFSWRTDLAYFAVGQRSAEFFASQIERAVLYPYRQESSEGLLALDA
MQDLSEKHILILRGNGGREYFSEQAQLRGAKVETLECYQRVPTAYNNAEQISICKRAGIN
RLVISSAEILQYLVDFVPESEHNWLKSCQLVTVSQRIANLAKQLGWCDVVVSPRADNVHL
LKTLLSAD
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcggtattagtcactcgacctgatgtgcgaggcgcacagttaacagagatgttgatt
caagcggggatttttgcaatccatttaccgctctttacgatcgaaacaggacgagaattg
aatgacttgccgaataaactgtcgcaacttaaagcgggtgattatgtttttgcagtttca
aaacatgctgttcagtatgcagtcgatacgttaaagaatacagggttttcttggcgaaca
gatttagcctattttgcggtaggacagcgcagtgctgaattttttgccagtcaaatcgaa
cgtgcggtattgtatccttatcgacaggaaagtagcgaaggattattagcactggatgcc
atgcaagatttgtcagaaaagcacattttaattttacgcggcaatgggggacgtgagtat
ttttctgaacaggcacaattgcgtggtgctaaagtggagacgctcgaatgttaccagcgt
gtaccgactgcctacaataatgcagagcagatcagtatttgtaagcgtgcaggaattaat
cggcttgtgattagcagtgcagaaattttgcagtatcttgtggattttgttccagaaagc
gaacataattggctaaaaagttgtcagctggtgacggtaagtcagcgtattgccaattta
gccaaacaattgggttggtgtgatgtggtggtttcaccgcgagcagataacgtgcattta
ctaaaaacattgctgtctgcggactaa

DBGET integrated database retrieval system