KEGG   Pasteurella multocida subsp. multocida Pm70: PM1813Help
Entry
PM1813            CDS       T00046                                 

Gene name
hemX
Definition
protein HemX
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pmu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2042885..2043631
Genome map
AA seq 248 aa AA seqDB search
MAVLVTRPDVRGAQLTEMLIQAGIFAIHLPLFTIETGRELNDLPNKLSQLKAGDYVFAVS
KHAVQYAVDTLKNTGFSWRTDLAYFAVGQRSAEFFASQIERAVLYPYRQESSEGLLALDA
MQDLSEKHILILRGNGGREYFSEQAQLRGAKVETLECYQRVPTAYNNAEQISICKRAGIN
RLVISSAEILQYLVDFVPESEHNWLKSCQLVTVSQRIANLAKQLGWCDVVVSPRADNVHL
LKTLLSAD
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcggtattagtcactcgacctgatgtgcgaggcgcacagttaacagagatgttgatt
caagcggggatttttgcaatccatttaccgctctttacgatcgaaacaggacgagaattg
aatgacttgccgaataaactgtcgcaacttaaagcgggtgattatgtttttgcagtttca
aaacatgctgttcagtatgcagtcgatacgttaaagaatacagggttttcttggcgaaca
gatttagcctattttgcggtaggacagcgcagtgctgaattttttgccagtcaaatcgaa
cgtgcggtattgtatccttatcgacaggaaagtagcgaaggattattagcactggatgcc
atgcaagatttgtcagaaaagcacattttaattttacgcggcaatgggggacgtgagtat
ttttctgaacaggcacaattgcgtggtgctaaagtggagacgctcgaatgttaccagcgt
gtaccgactgcctacaataatgcagagcagatcagtatttgtaagcgtgcaggaattaat
cggcttgtgattagcagtgcagaaattttgcagtatcttgtggattttgttccagaaagc
gaacataattggctaaaaagttgtcagctggtgacggtaagtcagcgtattgccaattta
gccaaacaattgggttggtgtgatgtggtggtttcaccgcgagcagataacgtgcattta
ctaaaaacattgctgtctgcggactaa

DBGET integrated database retrieval system