KEGG   Pasteurella multocida subsp. multocida Pm70: PM1896Help
Entry
PM1896            CDS       T00046                                 

Gene name
proB
Definition
(GenBank) ProB
  KO
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PM1896 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PM1896 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PM1896 (proB)
Enzymes [BR:pmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PM1896 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2136713..2137873
Genome map
AA seq 386 aa AA seqDB search
MINGKLASILCDKNKKIEKMKIDKTLVVKFGTSTLTQGSAKLNLPHMMDIVRQLAQLHQA
GFRLVIVTSGAIAAGRHYLNHPQLPPTIASKQLLAAVGQSQLIQTWEKLFAIYDIHIGQI
LLTRADIEDRERFLNARDTLRALLDNQIIPVINENDAVATSEIKVGDNDNLSALVAILVQ
AEQLYLLTDQQGLFDRDPRKHPDAKLIADVDKITDHIRAIAGGSGTSLGTGGMSTKISAA
DVATRSGIETIIAPGNRPNVIVDLAYGQAIGTKFSVQADRLESRKQWLYAAPSAGIITID
AGAENAMLMQHKSLLPAGIVNVEGRFSRGEVVKIRTQQGKDVALGMPRYNSDALHLIQGK
HSQDIEQVLGYEYGAVAVHRDDMIVL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgattaatggtaagttagcttcaattttgtgcgacaaaaataagaagatagagaagatg
aaaatcgacaaaacactcgttgtgaaatttggaaccagtacgcttacgcaaggatcggcg
aagttaaatttacctcatatgatggatattgtgcgtcagctcgcacagcttcatcaagcg
ggctttcgtttagtgattgtcacctcaggggcgattgcggcaggtcgtcattatttaaat
cacccgcaattgccgccgacgattgcctcgaaacaattattggctgcggtaggacaaagt
cagctcattcaaacgtgggaaaaattgtttgccatttatgatattcatattgggcagatt
ttattgacccgtgccgacattgaagatcgtgaacgttttttaaatgccagagatactttg
cgcgccttattagataatcagattattccagtgattaatgaaaatgacgctgtcgctacg
tcagaaattaaagtaggcgataacgataatttatccgcgttagtggcgattttagtgcaa
gcagaacagttgtatttgcttactgatcagcaaggtttgtttgatcgtgatccgcgcaaa
catccagacgccaaattgatcgccgacgtggacaaaattaccgatcatattcgcgcgatt
gcgggcggaagtggcacctcgttaggcacaggcggcatgtccaccaaaatcagtgccgcg
gatgtggcaacccgctccggcattgaaactattattgcaccgggtaatcgcccgaatgtg
attgtggacttagcttatgggcaagccattggcaccaaatttagtgtgcaagcagatcgc
ttagaaagtcgtaaacaatggctatatgcggcgccgtcagccggtattattaccattgat
gcgggggcggaaaacgcgatgttaatgcaacataaatcgttattgcctgctgggattgtg
aacgtggaaggacgcttttcacgcggtgaagtggtaaaaattcgtactcagcaaggtaag
gatgtcgccttagggatgccacgttataacagcgatgcactccatttaattcaaggcaaa
cattcgcaagatatcgaacaggttctcggttatgaatatggggcggttgcggtacaccgc
gacgatatgattgtgttataa

DBGET integrated database retrieval system