KEGG   Prunus mume (Japanese apricot): 103327327Help
Entry
103327327         CDS       T03196                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00052  Galactose metabolism
pmum00500  Starch and sucrose metabolism
pmum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmum00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103327327
   00500 Starch and sucrose metabolism
    103327327
Enzymes [BR:pmum01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103327327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 103327327
NCBI-ProteinID: XP_008227859
Position
LG4
AA seq 577 aa AA seqDB search
MAISSPLLYCFLSLWLGHAVHQLEASHQVYRNLPTYSQLTSSHHHPVNEPYRTGYHFQPP
KNWINDPNGPLIYKGIYHFFYQYNPLDVVWGNIVWAHSTSTDLVNWTPHDAAIYPSQPSD
INGCWSGSATILPGGKPVMLYTGIDSQNRQVQNLAYPKNLSDPFLREWTKIPQNPLMAPS
QANQINASSFRDPTTAWLGPDKKWRVIIGGKTNQTGEAILYRSKDFLNWVKAKQPLHSAE
KTGMWECPDFFPVSIHSQNGLDTSKIGPDVKHVFKVSLDNTRREYYTIGTYNIDKDIYIP
DKGSVESDSGLRYDYGKFYASKTFFDSSKNRRILWGWINESSTVEDDIKKGWSGLQAIPR
TLWLDKSGKQLVQWPAVEIEKLREKEVKLPSSVLKGGSVHEVLGVTAAQADVEITFGISD
LKKAEVLDPSWTNPQLLCSQKGASVKGGLGPFGLLVLASKGLKEYTSVFYRIFIDHNKHV
VLLCSDQSRSSLKKDNDKTTYGAFVNVDPLHEKLSLRSLIDHSIVESFGGEGKACITARV
YPTLAINGDAHLYAFNYGTEDVKITGSAWSLKTAKIN
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggccatctcctctcccttgctatactgctttctttctctttggctaggccatgctgtt
catcagcttgaagcttcccaccaagtttacagaaaccttccaacttattcccagttaact
tcttcacatcatcacccagttaatgaaccttacagaactggttatcatttccagcctccc
aagaattggatcaatgatcctaatggaccactgatttacaagggaatttatcatttcttc
tatcaatacaaccccttagatgtagtttggggaaacattgtctgggcccattccacatca
actgatcttgttaactggaccccacatgatgctgctatctacccatcacagccgtcagac
atcaacggctgttggtcgggttccgccacgatcctccctgggggcaaaccggtgatgtta
tacacaggaatagactcccaaaatcgccaagttcagaatttggcctaccccaagaacctc
tcggacccattccttagggagtggaccaagatcccacaaaatccactaatggcacccagc
caagctaaccaaatcaatgcaagctcatttagggacccaaccactgcttggctaggccca
gataagaaatggagagtgatcattggaggcaaaacgaaccaaacaggagaagctatccta
tataggagcaaagatttccttaattgggttaaggccaaacaaccacttcactcagcagag
aaaactggaatgtgggaatgccctgattttttcccagtttcaattcatagccaaaatggt
cttgacacatcaaaaattggtcctgatgttaagcatgtgttcaaggtgagcttagacaac
actaggcgagagtactacacaattgggacatataacatcgacaaggatatctatatcccg
gataagggctcagtggagagtgactcaggcttgagatatgattatggaaaattttatgct
tcaaaaactttctttgacagttctaagaaccgtagaatactgtggggttggattaatgaa
tcttcaactgtggaggatgatatcaagaagggatggtctggacttcaggcaattccaagg
accctttggcttgataagtctgggaaacaattggtacaatggccagcagtagagattgaa
aagctacgtgaaaaagaggtcaagttgccaagcagtgtacttaagggaggatcagtgcat
gaagtacttggtgtcacagcagcacaggcagatgtagagattacttttggaataagtgat
cttaagaaagcagaagtgctggacccaagttggacaaacccacagcttttgtgtagccaa
aagggtgcctcagttaaaggtggtttaggaccattcgggttactcgtattggcttcaaag
ggcttgaaagaatatacatcagttttctatagaatattcatagatcacaacaaacatgtg
gtgctcctgtgcagtgaccaaagcaggtcttccttaaagaaagataatgataagaccact
tatggggcttttgtaaacgtggatcctcttcatgagaagctctccctaagaagcttgata
gatcactctatagtggagagctttggtggagaaggcaaggcgtgcataacagctagagtt
tatcccacactggccattaatggcgatgcccacttgtatgctttcaattatggaactgag
gatgtcaaaatcacaggaagtgcatggagcttgaaaacagcaaaaatcaattga

DBGET integrated database retrieval system