KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_0195Help
Entry
PMCN06_0195       CDS       T01776                                 

Gene name
galM
Definition
galactose mutarotase, aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmv00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pmv00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
184621..185652
Genome map
AA seq 343 aa AA seqDB search
MLSKCTLGVAPDGQPFQLVTLSNAKGMSIQVMDWGATWLSCKVPVQNQLREVLLGCQLED
YPKQQVYLGATIGRYANRIANGRFVLNGVPIQLQTNQGQHQLHGGENGFDCQRWQLEKCG
ENFVCFSLSSPDGDQGFPGHVKVRVTYLLSEQNCVEIQFEAESDQDTPLNLTNHAYFNLN
NAELGEDIREHYLQVNADHYLPVNPEGIPCAALKSVQGTSFDFREMKSIEKDFLQDEQAL
VKGYDHAFLLNQDKEKLSAVLTAADGSLRLQVSTSQPALQVYTGNFLAGTPNRFGSYYQD
YVGIALETQALPDTPNHPEWWTLGGMSQAGEKYQHWTRFNFSS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcaagtgtacactgggtgtcgcaccagatgggcaaccatttcaattagtcact
ttatccaatgcaaaagggatgtctatccaagtgatggattggggggcgacatggttgtct
tgtaaggtgcctgtgcaaaatcaattacgtgaggtgttattaggctgtcagcttgaggat
taccctaagcaacaggtttatttaggtgcgactatcgggcgttatgcgaatcgtattgcg
aatggacgttttgtattaaatggggtgccgattcagttacagacgaatcaaggacaacat
cagttacatggtggcgaaaatggttttgattgccaacgttggcaattggaaaagtgcggt
gaaaattttgtgtgtttttcactttcttcgccagacggtgatcaaggttttcccggtcat
gtgaaagtacgtgtaacgtacttactgagcgagcaaaattgtgtagaaattcaatttgag
gcggaaagtgatcaagataccccactaaacttaaccaaccatgcttattttaatctcaat
aacgcggagcttggtgaggacattcgagaacattatttgcaagtcaatgctgaccattat
ttacctgtgaatccagaggggatcccttgtgcagcgttgaaatccgtacagggcaccagt
tttgattttcgtgagatgaagtctattgagaaagactttttacaagatgaacaagcccta
gtaaaagggtatgatcatgcctttctattaaatcaagacaaagaaaaactcagtgcggtt
cttacggcagcagacggttctttacgtttacaggtctccacctctcaacctgccttacaa
gtatatactgggaattttctagccggtacgccgaatcgtttcggctcatactatcaggat
tacgtcgggattgcgttagaaacacaagccttacctgatacccctaatcatcctgagtgg
tggacattgggcggcatgagccaagccggagaaaaatatcaacattggacccgttttaac
ttttcatcataa

DBGET integrated database retrieval system