KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_0253Help
Entry
PMCN06_0253       CDS       T01776                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PMCN06_0253 (ruvA)
Enzymes [BR:pmv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PMCN06_0253 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
252784..253398
Genome map
AA seq 204 aa AA seqDB search
MIGHLTGRLVEKHPPEILLDVQGVGYELLLPMTSFYQLPDIGQQIALFTHLVVREDAHLL
FGFSQKTDRTLFRELIKTNGVGPKLALAILSAMSVEEFAYAIEREELSKLVKIPGVGKKT
AERLLVELKGKFKGIQQEDFFIESQHLKQPEHALNEQDIPASEAISALIALGYKAAEAEK
LVKKISKPALSSEQLIREALKAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgattggccatttgacgggacgtttagttgaaaaacaccctcctgagattttgttagat
gtgcaaggcgttggctacgaattattattaccgatgaccagcttttatcagcttcccgat
attggtcaacagatagctctatttacccatcttgttgtgcgtgaagatgcacatttactg
tttggtttttcgcaaaaaaccgaccgcactttgtttcgtgaattaatcaaaaccaatggt
gtaggacctaagctcgcactggctattttatcagccatgtcagtggaagagtttgcttat
gcgattgaacgtgaagaactttctaaattagtgaagattcctggggttggtaagaaaaca
gcagaacgtttattagtggaattaaaagggaagttcaaaggcattcaacaagaagacttc
tttattgaaagtcaacatcttaaacagcctgaacatgccttaaatgaacaagatatccct
gccagtgaagctatttctgcgctgattgcgttaggttataaagccgcagaagctgaaaaa
ctggtgaaaaaaatcagcaagccggcactttctagtgagcaacttatccgtgaagcatta
aaagccgccttataa

DBGET integrated database retrieval system