KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_0272Help
Entry
PMCN06_0272       CDS       T01776                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III subunit psi
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
pmv00230  Purine metabolism
pmv00240  Pyrimidine metabolism
pmv01100  Metabolic pathways
pmv03030  DNA replication
pmv03430  Mismatch repair
pmv03440  Homologous recombination
Module
pmv_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PMCN06_0272 (holD)
   00240 Pyrimidine metabolism
    PMCN06_0272 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PMCN06_0272 (holD)
   03430 Mismatch repair
    PMCN06_0272 (holD)
   03440 Homologous recombination
    PMCN06_0272 (holD)
Enzymes [BR:pmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PMCN06_0272 (holD)
DNA replication proteins [BR:pmv03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PMCN06_0272 (holD)
DNA repair and recombination proteins [BR:pmv03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     PMCN06_0272 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi
Motif
Other DBs
NCBI-ProteinID: AFF23530
Position
complement(269813..270223)
Genome map
AA seq 136 aa AA seqDB search
MNRRDLLLQQMGITQWQLKSPTRLKGVVKINVEEKIRLIIVAEQALTTDSPLLKDILRSL
DLDESMCLCLDFERIPHLNTQYPVHYWLLSDNPEEIERLSAFCQPASAIWQSSAWSQFKH
SHHAKRQLWQQMQTTL
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaatagacgagatcttctgttacaacaaatgggtatcacacaatggcaactgaagtcc
cctactcgtttgaaaggggtggtaaaaattaatgtagaagaaaaaatacgtctcatcatc
gttgccgagcaagctctcacaacagattctccattattaaaagatattttacgtagctta
gaccttgatgaaagcatgtgcttatgcttggattttgaacgtatcccacatctaaatacg
caatatcctgtccattattggctactgagtgataatccggaagaaatcgaacgcctctcg
gctttctgtcaacccgcaagcgcaatttggcaaagtagcgcatggtcgcagtttaaacac
agccatcatgccaaacgccaactctggcaacaaatgcaaacaacgctatga

DBGET integrated database retrieval system