KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_0294Help
Entry
PMCN06_0294       CDS       T01776                                 

Gene name
yhjA
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Brite
Enzymes [BR:pmv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PMCN06_0294 (yhjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(291972..293378)
Genome map
AA seq 468 aa AA seqDB search
MRVKNLFFSVVAIAVASFLGTVGYVHIFDKEQSAKLLSQTPLSGQAQQVAKILYDNGCQY
CHSTNAELPFYAKFPVAESIMQEDIKKGTRVFLLNEILDGLKDPTKLSEVSLAKLEQVLI
NDEMPVAKFVHLHWGSRPDLEEKTTLLNWIREQRQNHFLPANTQGTDPTRLVQPIPDSVA
TDPLKVALGDMLYHDGRLSGDGTIQCHTCHQLKNGGVDGLDVSVGIDGLKGGINAPTVYN
SVFNILQFWDGRAKDLAEQAGGPPLNPVEMGSKNWEEIIAKFEQDEAFKAKFLAVYPAIN
EATITHAIAEFEKTLITPNSAFDRYLKGEQNALTAAQIRGYELFKQHKCDTCHVGVAMGG
QSFEYMGLFDDYFAARGTPITEADQGRFAHTQDPADMHKFKVPTLRNIALTAPYMHDART
SDLKEAVRIMLHYQSGKTLPTKDVEDISVFLESLTGEYQGKLLTKENQ
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaaaaatctattcttttccgttgttgccattgcagtcgccagctttttaggc
acagttggttatgttcatatctttgataaagaacaatccgctaaactgctatcgcaaacg
ccactaagtgggcaagcacagcaagtggcaaaaatcttgtatgacaatggctgtcaatat
tgtcatagtactaatgcagagttgcctttctatgctaagtttccagtggcagaaagcatt
atgcaagaagatattaaaaaaggcacacgtgtctttttgttaaatgagattcttgatggg
ttaaaagatcctactaaattgtctgaagtcagcctcgctaaattagaacaagttctgatt
aatgatgagatgcctgtcgcaaaatttgtgcatttacactggggatcacgtcctgattta
gaggaaaaaacaacgctattaaattggatacgtgagcaacgccagaatcattttctaccc
gcaaatacacaaggtacggacccaacgcgtttagtccaaccgattcctgatagtgtagca
acggatccactgaaagtcgcattgggtgacatgctataccacgatggacgtctttcaggt
gatggtacaatccaatgtcatacttgccatcagttgaaaaatggtggtgtagatggtcta
gatgtttctgtcggtattgatggtctcaagggaggaattaatgccccaacagtgtataac
tccgttttcaatattttacaattctgggatggacgagcaaaagatctcgctgaacaagcc
ggcggtcctcctctcaacccagttgaaatgggctctaagaattgggaagaaattatcgct
aaattcgaacaagatgaagcatttaaagccaagttcttagccgtttatcctgcgattaat
gaagccacaattacacacgccattgcggaatttgaaaaaacattgatcacaccaaacagc
gcatttgaccgttatttgaaaggcgaacaaaatgcactcacagccgcacaaatacgtggt
tatgagctcttcaaacagcacaaatgcgatacttgccatgttggcgtcgcaatgggtggg
caatcctttgagtacatgggcttatttgatgattactttgccgccagaggcacaccgata
acagaagctgatcaaggacgctttgcacatacccaagatcctgctgatatgcataaattt
aaggtaccgactctacgtaatattgctctgactgcaccatatatgcacgatgctcgcaca
tcggatctcaaagaagccgtgcgtattatgttacattatcaaagtggtaaaacgttaccg
accaaagatgtagaagatatcagtgtattcttagaatcactcaccggtgaatatcaaggc
aagttattaaccaaagaaaatcagtaa

DBGET integrated database retrieval system