KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_0500Help
Entry
PMCN06_0500       CDS       T01776                                 

Gene name
truC
Definition
tRNA pseudouridine synthase C
Orthology
K06175  
tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536306..537037
Genome map
AA seq 243 aa AA seqDB search
MTLEILYQDPYLIAVNKPAGMLVHRSWLDRHETQFVMQTLRDQIGQHVYPIHRLDRPTSG
VLLFALSSEVANLLCLQFENKQVQKSYLAIVRGYLVGEGRIDYPLKVQLDKIADKFAQDD
KVPQEAVTDYLGLAKVEMPYCVKKYSTTRYSLVRLIPRTGRKHQLRRHMKHLFHPILGDT
QYGDLHQNRALTAHTGVQRLMLHAERLIFTHPITQQLITICAGVDQQWLDLINIFDWDLN
SIH
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgacattagagattttatatcaagatccatatttgattgctgtaaataaaccagcaggt
atgttagttcatcgtagttggttagatcggcatgaaacacaatttgtcatgcaaacatta
cgcgatcaaatagggcagcatgtttatcctattcaccgtttagatcgaccgacttcaggt
gttttacttttcgcattaagtagcgaagtggcaaatttattgtgtcttcaatttgaaaat
aagcaagtgcaaaaaagttatttagcgattgttcgaggatatttagttggtgaggggcga
attgattatccactgaaagttcaattagacaaaattgcggataagtttgcccaagatgac
aaggtgccacaagaagcggtgacagattatctcgggttagctaaagttgaaatgccgtat
tgtgtgaaaaagtactcaacaacgcgttattcgcttgtgcgtttaattccgcgtacgggg
cgaaaacatcagctgcgtcgtcacatgaaacacctttttcatcctattttgggagataca
caatatggtgatttacaccaaaatcgtgcattaaccgctcatacgggcgtgcaacgttta
atgttacatgcagaacgattgatttttacacacccgataacacagcaactgatcacgatc
tgtgcgggtgtcgatcaacaatggctcgatttgattaatatttttgattgggatttaaat
tccatacattaa

DBGET integrated database retrieval system