KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_0543Help
Entry
PMCN06_0543       CDS       T01776                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PMCN06_0543 (recD)
Enzymes [BR:pmv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PMCN06_0543 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
578228..580201
Genome map
AA seq 657 aa AA seqDB search
MLATLKELKQHKVISEGDYYFAQLIAGKQPDELSREQKNLAILLAALCSYSYQQGNTCLF
LEKGLESNYFNLAYRTAEQHYLHIIQEKIAFLPIECWQSSLADHIAFTATPLENVAPLVF
QFNALYFYRIWQDEYRVAHYLQRAVQRGAETAPIAYEQIQAILMHYFPAVQQIEGVNWQK
VAVATALKQPFCLITGGPGTGKTTTVARLLLALQTLSACQLKIKLVAPTGKAAARLTESI
NGALTRLAQENMAISADLIASIPTTAQTLHRLLGIRFFEETPTFHPNNPLPLDVLVVDEA
SMIDLPLMAKLLQALKPNTKLILLGDENQLSPVEAGEMLGALSEFSQHAYSPTLTQYLKA
VADIELISSDQGSPLRDHLCRLHHSHRFSGDSGIGQLAQAINQGNVEVSWNAFTHFNDIE
MVDFDQVALLKGDNPSLYSQACAALVIKSAVEKYTDYLVKLKALQQQSPILNEQQVGEIF
VLFNAVRFLTALRVGELGVEQLNQKIAQRLQQKGLLDFKHERDWYLGKPIMIQQNDRHIG
LYNGDIGLFLGQGKVWFEQGQGHYKTVLASRVPNYETAFVMTVHKSQGSEFAHTCLVLPT
EPNPILSRELIYTGVTRAKQQLTVFSSAEIWKSAVKNPVKRQSGLNQLLVELFNKSD
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctaccttaaaagaattaaaacaacacaaggtgatcagtgaaggagattactac
tttgcgcaattgatcgcgggtaagcaaccagatgaactgtcgcgggaacagaaaaattta
gccatattgcttgccgcactttgtagttacagctatcaacaaggcaatacttgcttgttt
ctagagaaagggctggaatctaattattttaatttggcttatcgaacagcagagcagcat
tatctccatattattcaagaaaaaattgcttttctaccgattgaatgttggcaatcaagc
ttggcggatcatatagcgtttacagcaacgccgctggaaaatgtcgcccctttagtgttt
cagtttaatgcgctttatttttatcgtatctggcaagatgaataccgagttgctcattat
cttcaacgtgcagtacagcgtggggctgagacagcgcctattgcttatgagcaaatccaa
gcgatcttaatgcactattttcctgcggtacagcaaattgaaggggtgaattggcaaaaa
gtagcagtagcgaccgcgttaaaacaaccattttgtttgattacaggtggtccaggaaca
gggaaaaccactactgtcgcacgtttactcttggcgttacagacactttctgcgtgtcag
cttaagattaagttagttgcgcctacaggcaaagcggcagcacgcttgacggagtcaatt
aatggtgcgttaacgcgtttagcacaagaaaatatggcgatcagtgccgatttaattgcc
tctattccgactacagcgcagaccttacatcgtttattgggcatacgtttttttgaagaa
acacccacctttcatccaaacaatccattgccattggatgtgttggtggtcgatgaggcg
tctatgattgacttgccattaatggcgaaattattacaggcactcaaaccgaataccaaa
ttaattttgcttggagatgaaaatcaattgtctcctgtggaagcaggggaaatgttggga
gcgttgtctgagttttctcaacacgcctatagtcctacgttaacccagtatttaaaagca
gtggcggatattgagttaatttcgtcagatcaaggttccccgttgcgtgatcatttatgc
cgtttgcatcatagtcatcgtttttcgggggattctgggattgggcaattagcgcaggcg
attaatcaaggcaatgttgaggtaagttggaacgcatttacccattttaatgatatcgaa
atggtggattttgatcaggttgccttattaaaaggagataacccgagtttatatagccaa
gcgtgtgcagcattagtgataaaaagtgcggttgaaaaatacacagattatttagtgaaa
ctgaaagcattacaacaacagtcacctatactgaatgaacaacaagttggagaaattttt
gtcttgtttaatgcggttcgtttcttaacagcattacgcgttggagagctaggggtagaa
cagctaaatcagaaaatcgcgcaacgcttacaacaaaaaggcttacttgattttaaacac
gaacgcgattggtatttaggtaaaccaattatgatccagcaaaatgatcgccatattggc
ttatataatggcgacattggcttatttttaggacaaggtaaagtctggtttgagcaggga
caagggcattataaaactgtgctcgctagccgtgtgccaaactatgagaccgcgtttgtg
atgacggtacataaatcacaagggtctgagtttgcgcacacgtgtttggtattaccgacc
gaacctaacccgattttatcacgtgaattgatttatacaggcgtgacacgtgcgaaacag
caattaaccgttttttcaagtgccgaaatttggaaaagtgcggtgaaaaatccagtaaaa
agacaaagtggcttgaaccaattgttagttgaattatttaacaaatctgattag

  All links  
No link information was found.   
DBGET integrated database retrieval system