KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_0570Help
Entry
PMCN06_0570       CDS       T01776                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PMCN06_0570 (malQ)
Enzymes [BR:pmv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PMCN06_0570 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
604916..607009
Genome map
AA seq 697 aa AA seqDB search
MDIAYIRREAEKQGIAPSHYDINGNLIYASQETLTYFTDLLKSSSATSEAQLHFDDVVVF
LENEPIQYALTRLPVVNQTPLSCQIMDEAGKHILTQSCIERDIITLPALEFGYYHLRITY
ENHAYSVRLLISPKTAYQPPVLQQRKAWGLNVQLYSLRSKQNWGIGDFADLAYLVEQATK
YGVDFIGINPLHLMYSAVPEWASPYSSSSRRWLNPIYLSVTTLPEFKCCKSVQHWFASDE
IQDLLEQLQATELVDYAQVMWLKQNALEQLFAFSKRSQSTSIIQRRQAFLQFMQQQGEPL
LLQGLFEVLDRQSHSNMPTEKEIGWLGWRREWQQLSPAKRQTLLKTHQAEIEFYAWLQWL
ATEQLTDIQALCHRLGMNLGIYGDLAVNSSRGSADVWTDPELYFVNASVGAPPDPLGPVG
QNWNLPPYNPAILTRRGFQPFIDMLRSNMQHFGILRIDHVMGLFRLWLIPEEKSAADGVY
VHYPFDALMAILTIESQRNRCLIVGEDLGTVPDEVRSKLNQLHIFSYFVLYFEQRNRQYP
ASEQFPVKAFATIGTHDVPSLQSFWHCVDLQLFNQLGILDGEILQQKYEQRVIDKQALLD
TLHRDGYLPPHYEGNALSMAMHAHLNYVLHQYLARSCTQLIGVQLENVLSQEISFNLPGT
DREYPNWRKKLACTLEQMFSDKHITAFLSAIEQARHA
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcatacatccggcgggaggctgaaaagcaaggcattgcgccctctcattat
gacattaatgggaatttgatttacgccagccaagagacgttaacttattttacggattta
ttgaaatcttcgtcagccacatcagaggcacaattacattttgatgatgttgtcgtgttt
cttgaaaatgaaccgattcagtatgcattaacgcgtcttcctgtggttaaccaaacgcca
ctgtcttgccaaatcatggatgaagcgggtaaacatattctgacacaatcctgtattgag
cgtgacattatcaccttacctgcacttgagtttggttattatcatctgcggatcacttat
gaaaatcacgcttattctgtccgtttattgatcagtcctaaaacagcgtatcaaccccct
gtgttacagcaaagaaaagcatggggattgaacgttcaattatatagcttacgctcgaag
cagaattggggaattggggattttgcagacctagcgtatttagtcgaacaggcgacgaag
tatggtgtggattttattggtattaatccgttgcatttgatgtatagtgcggtaccagaa
tgggcgagcccttatagctcatcttctcgtcgttggttgaaccctatttatttatctgtg
accacattgccagaatttaaatgctgtaaaagcgtgcagcattggtttgcttccgacgag
attcaagacttgcttgagcagttacaagcaacagaattagtggattatgcacaagttatg
tggttaaagcagaatgcacttgaacaattgtttgctttctcaaagcgcagtcaatcgact
tctatcattcaacgccgtcaagcctttttgcaattcatgcaacagcaaggtgaaccgtta
ttgttacaaggcttatttgaagtattagaccgtcaatcgcactcaaatatgccaacagaa
aaagagattggctggctaggttggcgtcgtgaatggcaacagttaagcccagcaaaacgc
caaacgttactcaaaacgcatcaagcagagattgagttttacgcttggttacagtggtta
gcgacagaacaattaacggatattcaagcattgtgtcatcgcctcggcatgaatttgggg
atttatggtgatttggcagttaatagttcacgcggtagtgcggatgtgtggactgatccc
gaattgtactttgtgaacgcctccgtaggggcgccgccggatcctttaggacccgttggg
caaaactggaacttacccccttataatccagcgatcttaactcgccgtggttttcaacct
tttattgatatgttgcgtagtaatatgcagcattttgggatcttgcgtattgaccatgtg
atggggttattccgtttatggttgattcccgaagaaaaaagcgcagccgatggtgtgtat
gttcattatccctttgatgcgttaatggcgattttaacgatagaaagccaacgcaatcgt
tgcttgattgtaggggaagacttgggcactgtcccagatgaagtgcggtcaaaattaaat
cagttacacattttttcttactttgtcttatattttgagcaacgtaatcgtcaatatccc
gcaagtgaacaatttccagtgaaagcttttgctactattggcacgcatgacgtaccgtcg
ttacaaagtttctggcactgtgttgatttacaactttttaatcaactcggcattctagac
ggtgagatcttgcaacaaaaatatgaacaacgcgtgattgataaacaagcattattggac
acgttgcatcgtgatggctatttgccccctcattatgaaggaaatgccttatcaatggcg
atgcatgctcatcttaactatgtgttacaccaatatttagccagaagttgtactcaattg
attggggtacaactggaaaatgtattaagccaagaaatttcatttaatttacccggcact
gatagggaatatccaaactggcgtaaaaagctcgcatgtacacttgaacaaatgtttagt
gataagcatatcaccgcgtttttaagcgcgattgagcaagctcgtcatgcatga

DBGET integrated database retrieval system