KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_0608Help
Entry
PMCN06_0608       CDS       T01776                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
pmv00260  Glycine, serine and threonine metabolism
pmv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmv01100  Metabolic pathways
pmv01110  Biosynthesis of secondary metabolites
pmv01130  Biosynthesis of antibiotics
pmv01230  Biosynthesis of amino acids
Module
pmv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMCN06_0608 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMCN06_0608 (trpB)
Enzymes [BR:pmv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PMCN06_0608 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFF23860
Position
complement(654509..655717)
Genome map
AA seq 402 aa AA seqDB search
MSETLLNPYFGEFGGMYVPEILMPVLKNLEKAFVEAQQDPTFKETFLDLLKNYAGRPTAL
TRCRNLTQGSKTKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLGMPCQIYMGAKDVERQSPNVFRMRLMGANVTAVTKGSASLKDACCEAMRDWAE
NYEHTHYLLGTAAGPHPFPTIVREFQKIIGEETKQQILAREGRLPDAVIAAVGGGSNAIG
IFNDFIEETSVRLIGVEPAGKGIATGQHGAPLGHGTTGIYFGMKAPLMQTPDGQIEESYS
ISAGLDFPSVGPQHAHLQAIGRAQYESITDDEALSAFQALARHEGIIPALESAHALAYAL
KLIQRQPEKEQLLVVNLSGRGDKDIFTVDRILSQKGVSHAPF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaccttacttaatccctatttcggcgaatttggaggaatgtatgttcccgaa
attctgatgccggtgttgaaaaatctcgaaaaagcctttgttgaggcacaacaagatccc
acatttaaagaaaccttcctcgatttattgaagaactatgcaggtcgcccaactgcgctg
actcgctgtcgcaatctcactcaaggcagtaaaaccaaactgtacctgaagcgtgaagat
ttattgcacggcggtgcgcataaaaccaatcaagtattagggcaaatcttattagcgaaa
cggatgggcaaaacccgtattattgcggaaacgggggcgggacaacatggcgtagcaaca
gctctcgcttgtgccatgctcggtatgccatgccaaatctacatgggcgcaaaagatgtt
gaacgtcaatcgccgaatgtatttcgtatgcgtttaatgggggcgaatgtgactgcggta
acaaaaggctcagcctcattaaaagatgcctgctgtgaagccatgcgcgattgggcagaa
aactatgaacacacccattatttactcggcacagcagcaggtcctcatccctttcctact
atcgtgcgtgagttccaaaaaatcattggtgaagaaaccaagcaacaaattctagcacgc
gaagggcgtttacctgatgcagtcatcgccgcggttggtggggggtcaaatgccattggt
atattcaatgactttatcgaggaaaccagcgtacgtttaattggtgttgaaccagcgggc
aaaggaattgccactggacaacatggcgctccactaggtcatggcacaacaggaatctac
tttggtatgaaagcgccattaatgcaaacaccagatggacaaattgaagaatcgtattcg
atttcagcaggacttgattttccttctgttggtccacagcacgcacatttacaagcgatt
gggcgtgcccaatatgaatccattaccgatgatgaagccttatccgccttccaagcctta
gcacgccatgaaggcattattcccgcattagaaagtgctcatgccctcgcttatgcctta
aaactgattcagcgccagcctgaaaaagaacaactcttggtggtcaatttatctggacga
ggtgataaagatatttttaccgtagatcgcattttatcgcaaaaaggagtttcacatgcg
ccgttttga

DBGET integrated database retrieval system