KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_0610Help
Entry
PMCN06_0610       CDS       T01776                                 

Gene name
trpC
Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
pmv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmv01100  Metabolic pathways
pmv01110  Biosynthesis of secondary metabolites
pmv01130  Biosynthesis of antibiotics
pmv01230  Biosynthesis of amino acids
Module
pmv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMCN06_0610 (trpC)
Enzymes [BR:pmv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PMCN06_0610 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     PMCN06_0610 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI BtpA
Motif
Other DBs
NCBI-ProteinID: AFF23862
Position
complement(656714..658123)
Genome map
AA seq 469 aa AA seqDB search
MTQALPSILQKIIQDKTTWIAEKQAQLPLASFQDQLERSDRDFYQAMQQGSKQRPSYILE
CKKASPSKGLIRAAFDLTEIAEVYQHYATVISVLTDEKYFQGHFADIAQVRQRVTQPILC
KDFILSEYQVYLARYAQADAILLMLSVLNDERYTQLATLAHQLGMGVLTETSNEAEFARA
LALKAKVIGVNNRNLHDLSVDIQRVAQITQHYADQIPPGTKIISESGIYQHQQIRDLRHV
ADGFLIGSSLMQQTDLNHAVRSLLFGEHKVCGLTRPQDVRAVYQQGALYGGLIFVTHSKR
CISLRQAQELVTQAPLRFVGVFQDQSIAFICHLATQLRLHAVQLHGNENHEFIRQLRDEL
PVNCEIWRAICIESSGASPCQIVENENIDRYIFDSKTHQQRGGTGKTFDWQLIPHHLKPK
NMLAGGITPENIPLALAQGCLGLDLNSGLETYPGVKSHQKVVAAFAQLR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagcgcttccctctattctgcaaaaaatcattcaagataaaaccacttggatt
gcagaaaaacaagcacaattgcctttagcaagctttcaagatcagctagaacgtagtgat
cgtgacttttatcaagcgatgcaacaaggctcaaaacaacgcccttcatatatcttagaa
tgtaaaaaagcctctccctcaaaaggcttaattcgtgcagcgttcgatttaaccgagatt
gccgaggtttatcaacactatgctacggtcatttccgtcttaaccgatgaaaaatatttt
caagggcattttgctgatattgctcaagtacgccaacgcgtgacacaaccgattttatgt
aaagattttatcttatccgaataccaagtatatttagcacgatacgcacaagctgatgcc
attttattgatgctttccgttcttaatgatgaacgctatacacaattagccacattagca
caccaattagggatgggcgttttaactgaaaccagtaatgaggcagaatttgcgcgcgca
ttagcgttaaaagcgaaagtgattggtgtcaataatcggaatttacatgatctcagtgta
gacatacaacgtgttgcccagatcactcaacactatgccgatcagattcctcctggaacc
aaaattatcagtgaatctggtatctatcaacaccaacaaattcgagacttacgccatgtt
gccgacggttttttaattggcagtagtttaatgcaacagacagatttaaatcatgcggta
cgctcacttctttttggggaacataaagtttgtgggctcacccgtccacaagatgtaaga
gcggtttaccagcaaggtgcactttacggtggactgatttttgtgacacactcaaaacgt
tgtattagcttacgtcaagcccaagaattagtcacacaagccccattgcgctttgttggg
gtatttcaagatcaatccatagcgtttatctgtcaccttgcaactcaattaagactccac
gccgtccaattacatggcaacgaaaaccacgaatttattcgccaattacgcgatgaattg
ccagtgaattgtgaaatttggcgcgccatttgcattgagagtagcggcgccagtccgtgt
caaatcgtggaaaatgaaaatattgatcgttatatttttgacagtaaaacgcatcaacaa
cgtggcggaacggggaaaacatttgattggcaattgatccctcatcacttaaaacccaaa
aatatgttagctggtggtattacaccagaaaatatccctctggcgctcgctcaaggctgt
ttaggactggatttaaattcagggcttgaaacttatcctggtgtaaaatcacaccaaaaa
gtcgttgcagcttttgctcaactccgctaa

DBGET integrated database retrieval system