KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_0770Help
Entry
PMCN06_0770       CDS       T01776                                 

Definition
glucose-6-phosphate 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMCN06_0770
Enzymes [BR:pmv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PMCN06_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
822499..823320
Genome map
AA seq 273 aa AA seqDB search
MYHAIQPIILQQICPELRLVKYNAIPAISLQHDIGNAVIALQGAQLLSWQPKGSAHDVLW
LSEIEPFQLGKAIRGGIPLCYPWFGPVKTPSHGTARIRLWHLIDYVISTDKVRLVFGLFT
EDHLIEAKVSIDFAQDCQIRLTHYGQEDAQVALHSYFHVGDIEQIEIQGLPTHCVSNLTK
QHENVPSPRQIQQNVDCTYHITNAKTSIVDPVLQREISLEHQQASEVVLWNPWHKETSGM
SEFGYQTMVCVETARITQQLKQGEEIAVRITLK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacgctattcaaccaataattttgcaacagatttgtcctgaactccgtttagtg
aaatacaatgcaattccagccattagcttgcaacatgacattggtaacgcggtgattgcc
ttacaaggtgctcagcttctcagttggcaaccgaaaggcagtgcacacgatgttctatgg
ctaagcgaaattgaacctttccaattaggcaaggccattcgtggcgggattccactttgc
tatccatggtttggacctgtgaaaacaccttctcatggcaccgcacgtatccgcttatgg
cacttaatcgactatgttatttcaactgataaagtgcggttagtttttggtttatttact
gaagatcatctcattgaagccaaagtcagcatagattttgctcaagattgccaaataagg
ttgacccattatggacaagaagacgcgcaagtggcattacacagctattttcacgtcggc
gatattgaacaaatagaaatacaaggcttaccgactcactgtgtcagtaatctgacgaaa
cagcatgaaaatgtgccttctccccgccaaattcagcaaaatgtggactgtacctatcac
atcacaaatgcgaaaacgagcatcgttgaccccgttttacaacgcgagatttctcttgaa
catcaacaggctagcgaggtcgtgctatggaatccatggcacaaagaaaccagtggcatg
agtgagttcggctatcaaactatggtatgcgtagaaacagcacgtattacacagcaactc
aaacagggcgaagaaatagccgttcgtatcacgttaaaatag

DBGET integrated database retrieval system