KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_1014Help
Entry
PMCN06_1014       CDS       T01776                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PMCN06_1014 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PMCN06_1014 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PMCN06_1014 (sucB)
Enzymes [BR:pmv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PMCN06_1014 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1101669..1102883)
Genome map
AA seq 404 aa AA seqDB search
MSNFEIITPDLPESVADATVVTWHKKVGDVVKRDEILVEIETDKVVLEVPAQSDGVLEAI
IEAEGATVISKQLLGKLSATAVAGGVTKETVVTQEPTPADRHHANLSTESVGSDSVSPGV
RRLIAEHDLNAEDIKGSGVGGRITREDVEKVIAQKANKAPNKPAEPAFVVGNREEKRVPM
TRLRKRIAERLLEAKNSTAMLTTFNEVDMAPIMKLRKTYGEKFEKQHGTRLGFMSFYIKA
VVEALKRYPEVNASIDGDDIIYHNYFDISIAVSTPRGLVTPVLRNCDKLSMADIEKEIKA
LADKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPVAVNGE
VVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLEI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattttgagattataactcccgatttaccagaatctgtcgccgatgcaacggtt
gtaacttggcataagaaagtgggtgatgtcgtaaaacgtgatgagattttagtcgaaatt
gaaaccgataaagtggtacttgaagtcccagcacaatctgatggtgtacttgaagcgatt
attgaagcagaaggcgccaccgttatcagtaaacaattattaggtaaattgtcagccaca
gccgtagcgggtggtgtcactaaagaaacggttgtcactcaagagccaacgccggcggat
cgccatcatgcgaatttaagtactgaatcagtgggtagcgactcggtgagcccgggggta
cgtcgtttaattgctgagcatgacttaaatgcagaagacattaaaggaagcggtgtgggc
gggcgtattacacgcgaagatgtggagaaagttatcgcgcaaaaagccaataaagcgccg
aataagccggctgaacccgcgtttgtcgtcggtaatcgtgaagaaaaacgtgtaccaatg
acgcgtttacgcaaacgtattgcggagcgtttgttagaagcgaaaaacagcacggcaatg
ttaaccacatttaacgaagtggatatggcgccgattatgaaattacgtaaaacttatggt
gagaagtttgaaaaacaacatggcacgcgtctcggttttatgtcgttctacattaaagca
gtggtggaagcgctaaaacgttatccagaagtcaatgcgtcgattgatggtgacgatatc
atttatcataactatttcgatatcagcatcgcggtttcgacaccacgtggtttagttacc
ccagtattacgcaactgcgataaattaagcatggcggatattgaaaaagaaattaaagcg
cttgctgataaggggcgtgacggaaaattaacagttgaagatttaaccgggggtaacttt
accattactaatggtggtgtgttcggttccctcatgtctaccccgattatcaatcctcca
caaagtgccattttaggcatgcatgccattaaagatcgccctgtggcggtgaatggcgaa
gtggtgattcgtccgatgatgtatcttgcgctctcctatgatcatcgtttaattgatggt
cgtgaatcagttggtttcttagtaacgattaaagagttgttggaagatccaacccgttta
ttgttagaaatctaa

DBGET integrated database retrieval system