KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_1093Help
Entry
PMCN06_1093       CDS       T01776                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
pmv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PMCN06_1093 (recR)
DNA repair and recombination proteins [BR:pmv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     PMCN06_1093 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PMCN06_1093 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH DUF4248 Ribosomal_L7Ae HHH_5 Orthopox_F8
Motif
Other DBs
NCBI-ProteinID: AFF24335
Position
complement(1189870..1190472)
Genome map
AA seq 200 aa AA seqDB search
MQTSPLLEHLIESLRCLPGVGPKSAQRMAYHLLQRNRNGGMELARALTEAMSKIGHCSHC
RTFTEEEVCTICNNPRRQHSGLLCVVEQPSDIQAIEQTGQFSGRYFVLMGHLSPLDGIGP
KEIGLHLLQKRLQEESFHEVILATNPTVEGDATANYIAELCMQQNIKVTRIAHGIPVGGE
LEMVDGTTLTHSFLGRRQLG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccattactcgaacatttgatcgaaagtttacgttgtttacccggtgtt
ggaccaaaatctgctcaacgtatggcatatcacttattacaacgtaatcgtaatggcggc
atggaacttgctcgcgctttaacggaagcgatgtcaaaaatcggacattgcagccattgt
cgtacttttacggaagaagaggtgtgcacgatttgtaacaaccctcgccgtcagcattca
ggactactttgtgtggttgagcagccgtctgatattcaagctattgaacaaacaggacaa
ttttcagggcgttattttgtgttaatggggcatttatcgccattagatggaattggtcct
aaagaaattggtttgcatttattacaaaaacgcttgcaagaagaaagctttcatgaagtg
attttggctactaacccaaccgtcgaaggtgatgccacagcaaattacatcgcagagctt
tgtatgcaacaaaatatcaaagtcacccgtattgcgcatgggattccagtggggggggaa
ttagaaatggtggatggtacaaccttgactcattcctttttaggacgtcgccaactcggg
taa

DBGET integrated database retrieval system