KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_1188Help
Entry
PMCN06_1188       CDS       T01776                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMCN06_1188 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMCN06_1188 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PMCN06_1188 (thrC)
Enzymes [BR:pmv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PMCN06_1188 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1279565..1280839)
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKHPEEQVNFAQAVRQGLGKNQGLFFPETLPHFEDMDALLALPLVERSQKILSAL
IGEEISPTQLAKMVENAFTFPAPVAKVEEGVYALELFHGPTLAFKDFGGRFMAQALATVR
GEGKITILTATSGDTGAAVAHAFYGLENIDVVILYPQGKISPLQEKLFCTLGGNIRTIAI
NGDFDDCQALVKQAFDDAELRQTIGLNSANSINISRLLAQVCYYFEAVAQLPKAARDNLV
VSVPSGNFGNLTAGLIAKSLGLPIKRFVASTNVNDTVPRYLRSGNWQPHDTVATLSNAMD
VSRPNNWPRVEELFKRNGWALSNLHSDAVNDNETEQTLKAMYAKGYLCEPHGAVAYRVLK
QDLQPGETGLFLCTAHPAKFKESVERILALELPLPDALAKHAALPLLSDIMENDFAKLRA
YLLA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaacattaaacatccagaagaacaagtcaattttgcgcaagcggtacgt
caagggttaggcaaaaaccaggggttattttttccagaaaccctaccgcactttgaggat
atggatgcgctgttagcgttaccattggtggagcgtagccagaagattttatctgcgtta
attggtgaggaaatttcgccaacccagttagcaaaaatggtagaaaatgcctttactttc
ccagcacctgtagcaaaagtggaagaaggtgtttatgcactcgaattatttcatggtcca
accttagccttcaaagactttggtggtcgtttcatggcacaagccttagccacagtacgt
ggtgagggtaaaattacgattttaacggcaacgtcaggggatactggagcggcggttgcc
cacgctttttatggtttagaaaacattgatgtggtgattttatatccacaaggcaaaatc
agcccgctacaagaaaagttattctgtacgcttggtggcaatattcgtacgattgcaatc
aacggggattttgatgattgtcaggcattagtgaaacaagcgtttgatgatgcagagttg
cgtcaaacgattggcttaaattcagcaaattcgatcaatatcagccgtttattagcgcag
gtttgttattattttgaggcggttgcgcaattaccaaaagcggcacgcgataatctagta
gtgtcggtaccaagtggtaactttggtaacctgaccgcaggcttaattgccaagtcttta
ggcttgccaattaaacgttttgtggcgtcaaccaatgtgaatgataccgtaccgcgttat
ttacgcagtggcaattggcaaccgcatgacacggtggcgacgttatccaatgcaatggat
gtgagtcgtccaaataactggccacgggttgaagagttatttaaacgcaatggttgggcg
ctatcaaatttgcattctgatgccgtaaatgacaatgaaacggaacaaaccttaaaagcc
atgtatgccaaagggtacttgtgtgaaccacatggtgcggtggcttatcgtgtgttaaaa
caagatttacagccaggtgaaaccggcttattcctctgtacggcacatcctgcgaaattt
aaagaaagtgttgaacgtattttagcgcttgaattacctttacccgatgcattagcaaaa
cacgcggctttaccgttgctttcggatatcatggaaaatgattttgctaaattacgtgcg
tatttgttagcttaa

DBGET integrated database retrieval system