KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_1416Help
Entry
PMCN06_1416       CDS       T01776                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Brite
Enzymes [BR:pmv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PMCN06_1416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1503675..1504148
Genome map
AA seq 157 aa AA seqDB search
MSDHSTEIRTGERGLEIIGNAEGCAREPYRCPADVLTVGIGSTELSGLQIERKKYSDEEI
AQRWVNDIKVAEKCVNDWANGKNLPQGAFEAIVSITFNVGCSKLKHSTLFKHAKNGDIQA
MCDQFPRWKYANGKVLRGLEIRRQKERELCLADLHKS
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcactcaactgagattcgcaccggtgaacgtggactagaaatcattggtaat
gctgagggctgcgctcgtgagccttatagatgccctgctgatgttctaacggttggtatt
ggctcaacagaattaagcggacttcaaattgaacgtaaaaaatattcagatgaagaaatt
gctcaacgttgggtaaatgacattaaggttgcagagaaatgtgttaatgactgggcaaac
gggaagaatttgccgcaaggtgcatttgaggcaatagtgtcaatcacatttaatgtcgga
tgttctaagcttaagcattctacattgtttaagcacgctaaaaatggtgatattcaagca
atgtgcgatcaatttccacgctggaaatacgctaacggtaaagtattacgtggacttgaa
atccgcagacaaaaggaacgtgagctatgtttagccgacttacacaaatcttga

DBGET integrated database retrieval system