KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_1475Help
Entry
PMCN06_1475       CDS       T01776                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMCN06_1475 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PMCN06_1475 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PMCN06_1475 (proB)
Enzymes [BR:pmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PMCN06_1475 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1558436..1559539)
Genome map
AA seq 367 aa AA seqDB search
MKIDKTLVVKFGTSTLTQGSAKLNLPHMMDIVRQLAQLHQAGFRLVIVTSGAIAAGRHYL
NHPQLPPTIASKQLLAAVGQSQLIQTWEKLFAIYDIHIGQILLTRADIEDRERFLNARDT
LRALLDNQIIPVINENDAVATSEIKVGDNDNLSALVAILVQAEQLYLLTDQQGLFDRDPR
KHPDAKLIADVDKITDHIRAIAGGSGTSLGTGGMSTKISAADVATRSGIETIIAPGNRPN
VIVDLAYGQAIGTKFSVQADRLESRKQWLYAAPSAGIITIDAGAENAMLMQHKSLLPAGI
VNVEGRFSRGEVVKIRTQQGKDVALGMPRYNSDALHLIQGKHSQDIEQVLGYEYGAVAVH
RDDMIVL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgacaaaacactcgttgtgaaatttggaaccagtacgcttacgcaaggatca
gcgaagttaaatttacctcatatgatggatattgtgcgtcagctcgcacagcttcatcaa
gcgggctttcgtttagtgattgtcacctcaggggcgattgcggcaggtcgtcattattta
aatcacccgcaattgccaccgacgattgcctcgaaacaattattggcagcggtgggacaa
agtcagctcattcaaacgtgggaaaaattgtttgccatttatgatattcatattgggcag
attttattgacccgtgccgacattgaagatcgtgaacgttttttaaatgctagagatact
ttgcgcgccttattagataatcagattattccagtgattaatgaaaatgacgctgtcgct
acgtcagaaattaaagtaggcgataacgataatttatccgcgttagtggcgattttagtg
caagcagaacagttgtatttgcttactgatcagcaaggtttgtttgatcgcgatccgcgc
aaacatccagacgccaaattgatcgccgacgtggacaaaattaccgatcatattcgcgcg
attgctggcggaagtggcacctcgttaggcacaggcggcatgtccaccaaaatcagtgcc
gcggatgtggcaacccgctccggcattgaaaccattattgcaccgggtaatcgcccgaat
gtgattgtggacttagcttatgggcaagccattggcaccaaatttagtgtgcaagcagat
cgcttagaaagtcgtaaacaatggctatatgcggcgccgtcagctggtattattaccatt
gatgcgggggcggaaaacgcgatgttaatgcaacataaatcgttattgcctgctgggatt
gtgaacgtggaaggacgcttttcacgcggtgaagtggtaaaaattcgtactcagcagggc
aaggatgtcgccttagggatgccacgttataacagcgatgcactccatttaattcaaggc
aaacattcgcaagatatcgaacaggttctcggttatgaatatggggcggttgcggtacac
cgcgacgatatgattgtgttataa

DBGET integrated database retrieval system