KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_1622Help
Entry
PMCN06_1622       CDS       T01776                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pmv00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pmv00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1727135..1728457)
Genome map
AA seq 440 aa AA seqDB search
MATYFDKIEKVNYEGVTSSNPFAYKHYDANQVILGKTMAEHLRLAVCYWHTFCWTGNDMF
GVGSFDRCWQKASDSLAGAKQKADIAFEFFSKLGIPYYCFHDVDVAPEGHSFKEYLSNFN
TMIDVLAQKQEETGVKLLWGTANCFTHPRYMSGAATNPNPEVFAWAAAQVFTAMGATQRL
GGENYVLWGGREGYETLLNTNLKQEREQIGRFMQMVVEHKYKIGFNGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHTFQHEVAMATALDIFGSIDANRG
DPQLGWDTDQFPNSVEENTLVIYEILKAGGFTTGGFNFDAKIRRQSTDPYDLFHGHIGAI
DVLALSLKCAAKMLEEQALQKVVNQRYAGWTSSLGQQILLGQTSLAELAQRVEVQGFDPQ
PISGQQEYLENLVNHYIFSK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggccacttacttcgacaaaattgaaaaagtaaattatgaaggtgtaacttcatctaat
ccgtttgcatataagcattatgatgctaatcaagttattttaggtaagacgatggctgaa
cacttacgtttagccgtctgttattggcacactttctgttggacagggaatgatatgttc
ggtgtcggttctttcgatcgttgttggcagaaggcgagtgattcattagcaggtgcaaaa
caaaaagcagatatcgcttttgaatttttcagtaaattaggcataccttattattgtttt
catgatgttgatgttgcgccagaaggtcattcatttaaagaatatttgtcgaactttaat
acaatgatcgatgttttagcgcagaaacaagaagaaacaggcgtcaaattgttgtggggg
actgcaaattgttttacacaccctcgttatatgtctggtgctgcaacaaatccgaatcca
gaagtttttgcttgggctgctgcacaagtatttactgccatgggggcaactcagcgttta
ggtggtgaaaattatgttttgtggggaggacgtgaaggatatgaaacgttattaaatacc
aatttaaaacaggagcgagagcaaattggacgttttatgcaaatggtggttgagcataaa
tataaaatcggttttaacgggactttgctgattgaaccaaagccacaagagccaacgaaa
catcaatatgactatgatgtggcgaccgtttatggctttttaaagcagtttggtttagaa
aaagaaattaaagtgaatattgaagctaatcacgcaacattagctggacacactttccag
catgaagtcgccatggctacagcgttagatatttttggttctattgatgcaaatcgtggt
gatccacaattaggttgggataccgatcaattccctaatagcgtagaagaaaatactttg
gtcatatatgaaattctcaaagcagggggctttacaaccggtggttttaattttgatgct
aaaatccgtcggcagagtacggatccttacgatttatttcatggacatattggcgcgatt
gatgtacttgccttatcactaaaatgtgcggcgaaaatgcttgaagagcaagctttacaa
aaagtcgtcaatcaacgttatgctggttggacatcatcacttggtcaacaaatcttacta
ggtcaaacttcgttagctgagctggcccagcgagtagaagtgcagggattcgatccacaa
cctatttcgggtcaacaagaatatttggaaaacctcgttaatcactatattttcagtaaa
tag

DBGET integrated database retrieval system